KEGG   Tolumonas auensis: Tola_2505
Entry
Tola_2505         CDS       T00904                                 

Definition
(GenBank) deoxyxylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
tau  Tolumonas auensis
Pathway
tau00730  Thiamine metabolism
tau00900  Terpenoid backbone biosynthesis
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Tola_2505
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tola_2505
Enzymes [BR:tau01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     Tola_2505
SSDB
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C TPP_enzyme_C Transketolase_N E1_dh PFOR_II
Other DBs
NCBI-ProteinID: ACQ94099
UniProt: C4LAC4
Position
2734568..2736451
AA seq 627 aa
MSDNNKHMMIDMTEYPTLASVNSPADLRQFPEERLTQLCQELRTFLLHSVSRSSGHLASG
LGVVELTVALHYVYQTPVDKLVWDVGHQAYPHKILTGRRDRMATIRQKDGVHPFPWREES
EYDPLSVGHSSTSIGAALGMAVAAKRQGLDHKVVAVIGDGALTAGMAFEALNHAGDLHED
MLVILNDNEMSISENVGALNNHLAKWLSGPVYTTLREGGKKVLSGLPPVKELARRAEEHI
KGMVIPGTLFEELGFNYIGPIDGHDIKALVNTLKNMRQLKGPQLLHVMTKKGKGYEPAEK
DPIGYHGVPKFNPEDDCLPKNKGGKPTFSNIFGQWLCDMAESDSKLVGITPAMREGSGMV
EFSQKYPERYFDVAIAEQHAVTFAAGLAIEGMKPVVAIYSSFMQRAYDQIIHDVAIQNLP
VLFAIDRAGLVGADGPTHQGAFDISFLRTIPNMVIMTPSDENECRMMLTTGYQLNQPAAV
RYPRGTGSCVTLNTELETLPVGKGQIVRQGQSIALLCFGTLLHQAKSVAEKLDATLVDMR
FVKPLDAELLKTITAQHDVLVTIEENAVQGGAGSAVNEWMMTQRVLIPVLNIGLPDRFIE
QGTQEEIYHVLRLNSAGIEQRIREFMA
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgtcggataataacaaacacatgatgattgatatgaccgaatacccgacgctggcatca
gttaattcgccggcggatctgcggcaattcccggaagagcgtctgacgcaattatgtcag
gagctacgcacttttttgctgcactctgtaagccgtagcagtggccatctggcatccgga
ctcggagtcgtggaactgaccgtagcgctgcattatgtctatcagacaccggttgataag
ctggtatgggatgttggtcatcaggcttatccgcacaaaattctgaccggccgtcgcgac
cggatggcgacaatccgtcagaaggatggcgttcacccgttcccatggcgggaagagagt
gaatatgatccgctgagtgtcggtcactccagcacctccattggtgccgctttaggcatg
gcggtggcggccaaacggcagggtctggatcacaaagttgtggctgtcattggtgatggt
gcactgactgcaggaatggcattcgaagcgctgaatcatgccggtgatctgcatgaagat
atgctggtgatcctgaatgacaacgaaatgtcgatttcggaaaacgtcggcgcactcaac
aatcatctggcgaaatggttatccggcccggtctacaccacgctgcgggaaggcggcaaa
aaggtactgtctggcctgccaccggtaaaagagctcgctcgccgggcggaagaacatatc
aaaggcatggtaattccggggaccttgtttgaagagttgggctttaattatatcggcccg
attgatgggcatgacatcaaagcactggtcaatacactgaaaaatatgcggcagttaaaa
ggtccgcaactgctgcatgtgatgaccaaaaaaggcaaaggctatgagcctgccgaaaaa
gaccctatcggttatcacggtgtgccgaaattcaatccggaagatgactgcctgccgaaa
aacaaaggcggcaaaccgactttctcgaatattttcggtcagtggttatgcgatatggct
gagtctgacagcaaactggtgggcattacaccggcgatgcgggaaggctccggcatggtt
gagttctcgcagaaatatcctgagcgttattttgatgtcgcgattgccgaacagcatgcg
gtgacctttgccgccgggctggcgatagaaggcatgaaaccggtcgtggctatctattcc
agcttcatgcagcgggcttacgatcaaatcatccacgatgtggcgatccagaatctgccc
gtattgtttgccatcgatcgcgccggcctggtcggtgctgacgggccgacccatcagggt
gcatttgatatcagcttcctgcgcaccattccgaatatggtgatcatgacgccatcggat
gaaaacgaatgccggatgatgctgaccacgggctatcagttaaaccagcctgcagcggta
cgttacccccgcggtacaggcagttgtgtcactctgaacacagaactggaaacattaccg
gttggtaaaggtcagatcgtccgtcagggacaaagtattgccctgctctgcttcggtacg
ctgttacatcaggcaaaatccgtagccgaaaaactggatgccacactggtcgatatgcgg
tttgtgaagcctttggatgcagaattgcttaaaacgattacagcacagcatgatgtactg
gtgaccatcgaagaaaatgccgtacaaggtggtgcaggctctgccgttaatgagtggatg
atgacgcagcgcgtgttaataccggtattaaatattggtctgccggatcgctttatcgaa
caaggtacgcaggaagagatttatcatgttctccgactgaacagtgccggtattgaacag
cggatacgtgagtttatggcttaa

DBGET integrated database retrieval system