KEGG   Tolumonas auensis: Tola_2506
Entry
Tola_2506         CDS       T00904                                 

Definition
(GenBank) arsenate reductase
  KO
K00537  arsenate reductase (glutaredoxin) [EC:1.20.4.1]
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tola_2506
Enzymes [BR:tau01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.1  arsenate reductase (glutathione/glutaredoxin)
     Tola_2506
SSDB
Motif
Pfam: ArsC
Other DBs
NCBI-ProteinID: ACQ94100
UniProt: C4LAC5
Position
complement(2736532..2736957)
AA seq 141 aa
MSEVTIYHNPKCGTSRNTLEMIRNAGIEPNVILYLETPPTRDTLVKLIADMGISVREVLR
QKCDPYVELGLDDPKWTDEQLLDFMMQHPILINRPIVVTELGTKLCRPSELVLDILPAAQ
QGAFTKEDGEAVVDAEGKRLI
NT seq 426 nt   +upstreamnt  +downstreamnt
atgtctgaagtgactatttatcataatccaaaatgcggtacctcacgtaatacgctggaa
atgatccgcaatgccggtatcgaaccgaacgtgatcctgtatctggaaacaccgccaacc
cgcgatacgctggtaaaactgattgccgatatgggcatcagcgtgcgtgaagtgctgcgt
cagaaatgcgatccttatgttgagctggggctggatgatccgaaatggactgacgagcag
ttgcttgatttcatgatgcagcatcctattctgatcaatcgtcctattgtggtcacagag
ctgggcactaagctgtgtcgtccttcagaattggtacttgatatactgccggctgcgcaa
caaggtgcatttaccaaggaagacggtgaagcggtggttgatgcggaaggtaagcgtctg
atctaa

DBGET integrated database retrieval system