KEGG   Tolumonas auensis: Tola_2507
Entry
Tola_2507         CDS       T00904                                 

Definition
(GenBank) putative transcriptional regulator, ArsR family
  KO
K03892  ArsR family transcriptional regulator, arsenate/arsenite/antimonite-responsive transcriptional repressor
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tau03000]
    Tola_2507
Transcription factors [BR:tau03000]
 Prokaryotic type
  Helix-turn-helix
   ArsR family
    Tola_2507
SSDB
Motif
Pfam: HTH_20 HTH_5 TrmB RP-C HTH_24 HTH_IclR
Other DBs
NCBI-ProteinID: ACQ94101
UniProt: C4LAC6
Position
complement(2736980..2737288)
AA seq 102 aa
MKKESATLIFESLASGIRQDIYRLLVKCGQEGMVAGQIATTLGLPPNNLSFHLKAMAHAG
LLSVVQEGRYQRYRANVPLMRELIAYLTEECCGGNPEQCIPR
NT seq 309 nt   +upstreamnt  +downstreamnt
atgaaaaaagaatcagcaacactcatctttgaatcactggcatccggtatccggcaggat
atttatcgtttgctggtgaagtgtggtcaggaaggcatggtcgccggacaaattgcgact
acgctcggtctgccaccgaacaacctgtctttccatctgaaagcgatggcgcatgctggc
ctgttatcggtcgtgcaggaagggcgttatcagcgctaccgtgcgaatgttccactgatg
cgggaactgattgcatacctgaccgaagaatgttgtggcggcaatccggaacaatgtatt
ccacgttaa

DBGET integrated database retrieval system