KEGG   Tolumonas auensis: Tola_2508
Entry
Tola_2508         CDS       T00904                                 

Definition
(GenBank) Auxin Efflux Carrier
  KO
K13936  malonate transporter and related proteins
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tau02000]
    Tola_2508
Transporters [BR:tau02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Tola_2508
SSDB
Motif
Pfam: Mem_trans
Other DBs
NCBI-ProteinID: ACQ94102
UniProt: C4LAC7
Position
complement(2737358..2738293)
AA seq 311 aa
MSALLHQVYLSTPLFILVFIGYGVMRWAHWPKVMSDSLSRFVFSLALPAMLFHLMSDFSK
LPPVDARLLIAFFGGCLIIFILGRLLAWKVFKLDGVSQSVFALGGIFSNNSMLGLPLAKM
MLGDAALPSVALVLVFNSLILWTLVTVSVELAKHGSFSFRGFFSTVKSVLKNPIVFGILT
GTAWGLTGWKLPLLIDNTVSMISGAAAPMALLSLGMGLAEYGIGGNWGQSISVCLLKLVG
HPLVAWGIARLIGLPTMETQAIVLLASIATGVNVYLMARQFKTMEGVMATSLLLSTVVAA
VTTPLCVMLSG
NT seq 936 nt   +upstreamnt  +downstreamnt
atgtctgccttattacatcaagtctatctctcaaccccattgtttatcctggtgtttatc
ggctatggcgtgatgcgctgggcgcattggcctaaagtgatgtcggattctttgtcccgc
ttcgttttttcactggcattgccggcgatgctgtttcatctgatgagtgatttctccaaa
ctgccaccggttgatgcgcgcttgttgatcgcgttttttggcggctgcttaatcattttt
attctgggacgtttactggcctggaaagtctttaaactggatggcgtatcgcaatctgta
tttgccctgggcgggatcttctctaataactctatgctgggattgccactggcaaaaatg
atgttaggtgatgccgcattgccttcggtagcactggtgctggtatttaattcactgatc
ctctggacactggtgacggtatcggtggaattggcgaaacatggcagcttttcctttcgc
ggatttttctcaaccgttaaaagtgtgctgaaaaacccgattgttttcggcatcctgact
ggtaccgcatgggggctgacaggctggaaactgcctctattgattgataataccgtgagc
atgatcagcggtgcggcggcacctatggcgctgttatcgttagggatggggcttgcagaa
tatggcattggcggtaattggggacaatcaatcagcgtatgtctgctcaaactggttggt
catccgttagtcgcctgggggatcgcccgtctgattggcttacctaccatggaaacgcag
gcaatcgtgttgctggcatccattgctaccggggtgaacgtttacctgatggctcggcag
tttaaaacgatggaaggggtgatggcgaccagcctgttgctctctactgtagtggccgcg
gtcaccacgccgctttgtgtcatgttatccggatga

DBGET integrated database retrieval system