KEGG   Tolumonas auensis: Tola_2509
Entry
Tola_2509         CDS       T00904                                 

Definition
(GenBank) hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: DUF1189
Other DBs
NCBI-ProteinID: ACQ94103
UniProt: C4LAC8
Position
2738477..2739283
AA seq 268 aa
MRKITWWQALWLSFFSRTLYQSVARQWQGIGSLYLLIISALVVMPITMQIREGYLAFVEE
ELPLYLDEFPELTIQSGQASTPEERPYIINEKGTTEPFIVVDTTGQYTSLDQTSAAVLIT
TDRISIRKNDTDSQSYDFSDLTDMTIDRSSVETFMATTGQFLLPLTYVIMVAFSWFWRFT
QAMVYALFAGWLAKRQGVTLRYNSFVRICAVALTPAMILDMFIGVLGLPLPFAGLLFIVL
EVMYVRFAIQSVCQLPPDQRNDEGSIIA
NT seq 807 nt   +upstreamnt  +downstreamnt
atgcgcaaaatcacatggtggcaggctctctggctatcattcttttcccgaacgctatat
cagtctgttgcccgtcaatggcaggggatcggctcattatatttgttgatcatctcagca
ctggtcgtgatgcctattacgatgcagatccgggaagggtatcttgctttcgttgaagaa
gaattgccgctgtatctggatgaatttccggaactgacgattcagagcggtcaggcatcc
accccggaagaacgcccctatattattaacgagaaaggtacgactgagccgttcattgtc
gtggataccaccgggcaatacacgtcattagaccagacatcggcagcggtgcttattacg
actgaccgcatatctatccgtaaaaacgataccgattctcagtcctatgatttttcagat
ctgacggatatgacgattgatcgctcatcggtcgaaacatttatggcaactaccggtcaa
tttctgctcccgctgacctatgtgattatggtcgccttttcctggttctggcggtttaca
caagccatggtttacgccttgtttgccggatggctggcgaaaagacagggcgtgactctg
cggtataactcgtttgtccgcatctgtgcggtggcgctgacgcctgcgatgatccttgat
atgtttatcggtgttctcggcttaccgctgccctttgccggtctgttatttatcgtgctg
gaagtgatgtatgttcgcttcgccattcagagtgtctgtcagttaccacccgatcagcgt
aacgatgaaggctccatcatcgcgtaa

DBGET integrated database retrieval system