KEGG   Tolumonas auensis: Tola_2511
Entry
Tola_2511         CDS       T00904                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02033  peptide/nickel transport system permease protein
Organism
tau  Tolumonas auensis
Pathway
tau02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Tola_2511
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tau02000]
    Tola_2511
Transporters [BR:tau02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Tola_2511
SSDB
Motif
Pfam: BPD_transp_1 Mid2
Other DBs
NCBI-ProteinID: ACQ94105
UniProt: C4LAD0
Position
complement(2740301..2741278)
AA seq 325 aa
MLTFLFNRLAQALVVMFVISLVAFAIQDNLGDPLREMVGQGVSEAQREVLRNQLGLNDPF
MIKYSRFLTNAMHGDWGTSFIFKKPALDIILGKLVATLELVFAATFWIILISIPAGVYCA
IKPRGIGSKLIMGISTIGISVPVFLTAILLMYVFSIELGWLPSYGRGETVNLLGWESGLF
TIDGLKHLLLPSIALSSIMLPLFIRLVRAEMLEALSSEYVKFAWAKGLDKNKVWFRHALK
NTMLPLITVGGVQIGSMVAYTILTETVFQWPGTGFLFLEAITRVDTPLITAYVIFVGLVF
VVTNTLVDLLYGLINPTVKLTSKGG
NT seq 978 nt   +upstreamnt  +downstreamnt
atgctgacttttttgtttaaccgactggcgcaagctcttgtcgtgatgtttgtgattagt
ctggtagcgtttgctatccaggataatctgggtgatccgttgcgggaaatggtcggacaa
ggtgtgtccgaagcgcaacgtgaagtactgcgtaatcagttagggctgaatgacccgttc
atgattaagtattcccgtttcctgactaatgccatgcatggcgattggggaacctcattt
atttttaaaaaaccggcgttagatattatcctcggcaagctggttgcgacactggagctg
gtgtttgcggccacgttctggattatcctgatctctatcccggcaggtgtttattgcgcc
atcaagccccggggtattggcagtaaactgatcatggggatcagcaccatcggtatttct
gttccggtgtttctgactgcaattttgctgatgtatgtattttctattgaacttggctgg
ttgccgtcttatggccggggtgaaaccgtaaacctgctgggttgggagtccggtctcttt
accattgatggtttaaaacatctgttactgccgtcgattgcactttcttccattatgctg
ccgctgtttattcgtctggtgcgggctgaaatgctggaagcactcagttcagagtatgtg
aaatttgcctgggcgaaagggctggataagaacaaggtctggttccgccatgcactgaaa
aataccatgctgccgctgattactgtggggggagtgcagataggctcgatggtggcttat
accattctgactgaaaccgtctttcaatggccgggtacaggcttcttgtttctggaggcc
attacccgtgtcgatacgccgctgatcaccgcctacgttatctttgttggtctggtgttc
gtggtcactaataccttggtcgatctgctgtatggcttgatcaacccaacagtcaaactg
acgtccaagggaggctaa

DBGET integrated database retrieval system