KEGG   Tolumonas auensis: Tola_2512
Entry
Tola_2512         CDS       T00904                                 

Definition
(GenBank) extracellular solute-binding protein family 5
  KO
K02035  peptide/nickel transport system substrate-binding protein
Organism
tau  Tolumonas auensis
Pathway
tau02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Tola_2512
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tau02000]
    Tola_2512
Transporters [BR:tau02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Tola_2512
SSDB
Motif
Pfam: SBP_bac_5 GBS_Bsp-like
Other DBs
NCBI-ProteinID: ACQ94106
UniProt: C4LAD1
Position
complement(2741347..2742903)
AA seq 518 aa
MKTGMSKITALLLAAGISMPLYAADVKVALDADPESLDIYEQLSGGILQYAHMSFDPLVR
FTKDMKFEGRLAESWEQVDAKTVRFHLRKDVKFHSGNAFTADDVVWTYNRIMKSEDYKGL
FEVYEGMKKVDDYTVDLVAKVPYPLVLQNATYLFIMDSKFYTGKTEDGKDKDEIVKAANT
YAANHVSGTGPFKLVSREQGVKLTLERNKDYWDKKSPGNVNKLIVVPIKEDATRVAALLS
GDVDMIAPVAPNDQKRVMSDSDLQMVTETSNRIVMFELNQNVVPAFKDQRVREAVNLAVN
QKGIVDKIMKGFATPAGQMSPEGYLGHVPDLVPQYDLKKAKELMKAAGQEKGFEITMIAT
NNRYINDAKIAEAVANMLSKINIKVTLKTMPKAQYWPEYDKCAAGMQLIGWQSDTQDSGN
YFEYLVQTRNDKTGKGQYNCGGYSNAEVDKLIAESNGEVDVAKRTAMLQQIEKLLIKDAA
YLPLEWQNLSWAAKTKLDIKPIVNGLDFPYYGDLKVKE
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgaaaacaggaatgagcaaaattaccgctttgttactggctgccggtatctctatgccg
ttgtatgctgcggatgtcaaagttgcattagatgctgatccggagtcgctggatatctac
gagcaactgtcaggcggtattctgcaatacgcccatatgtcctttgatccactggtacgt
ttcaccaaggacatgaaatttgaaggccgtctggctgaatcatgggaacaggtggatgcg
aaaaccgtgcgtttccatctgcgtaaagatgtgaaattccactccggtaatgcttttact
gcggatgacgtggtgtggacttataaccgcattatgaagtccgaagactataaaggtctg
tttgaagtctacgaaggcatgaaaaaagtggacgattacaccgtcgatttagtggctaaa
gtgccgtatccgctggtgctgcagaacgcgacttacctgttcatcatggattccaagttc
tataccggtaagacagaagacggtaaagacaaagatgaaatcgtgaaagcagcaaatacc
tatgcggctaaccatgtttccggtacgggtccgttcaaactggtttcccgtgagcaaggc
gtgaagctgacgctggagcgaaacaaggattactgggataaaaaatcaccgggtaatgtg
aataagctgattgtggttccgattaaagaagatgcgacccgtgttgctgcattgctgtct
ggcgatgtagacatgatcgcaccggttgcgccgaacgatcagaaacgcgtgatgtcagac
tctgatctgcagatggtgaccgaaaccagtaaccgtattgtgatgtttgaactgaaccag
aatgtggtgcctgcattcaaagatcaacgcgtacgtgaagcggtgaatctggccgttaac
cagaaaggtatcgttgataaaatcatgaagggttttgcgaccccggctggtcagatgagc
cctgaaggttatctcggtcatgtaccggatctggttcctcagtatgatctgaaaaaagcc
aaagaactgatgaaggcggccggtcaggaaaaaggtttcgagatcacgatgatcgcgacc
aacaaccgctatatcaacgatgccaagatcgcggaagcggtggccaacatgctgtccaag
atcaacatcaaagtcacgctgaaaaccatgccaaaagcacaatactggccggaatatgac
aagtgtgcagctggtatgcagttgatcggctggcagtcagatacacaggattccggaaac
tacttcgaatatctggtgcagacccgcaatgataaaaccggtaaaggtcagtacaactgc
ggcggttactccaatgctgaagttgataagctgattgccgaatcaaacggcgaagtagac
gttgccaaacgtacagccatgctgcagcaaattgaaaagctgctgatcaaggacgcggct
tacttacctctggaatggcaaaacctgtcctgggcggcaaaaaccaagctggatatcaaa
cctatcgtcaatggtctggacttcccatactacggcgatctgaaagtaaaagagtaa

DBGET integrated database retrieval system