KEGG   Tolumonas auensis: Tola_2513
Entry
Tola_2513         CDS       T00904                                 

Definition
(GenBank) ABC transporter related
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
tau  Tolumonas auensis
Pathway
tau02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Tola_2513
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tau02000]
    Tola_2513
Transporters [BR:tau02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Tola_2513
SSDB
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_29 AAA_22 TniB AAA_16 RsgA_GTPase AAA_23 Mg_chelatase MMR_HSR1 PRK DUF87 MOLO1 G-alpha AAA_27 Phage_sheath_1 RPN6_C_helix
Other DBs
NCBI-ProteinID: ACQ94107
UniProt: C4LAD2
Position
complement(2742922..2744673)
AA seq 583 aa
MSLLEVRNLRIEYPSRYGVMAAVKDLSFSIEKGEILGVVGESGAGKSTIGNAIIDLLSPP
GRIARGDVFLNGEKISGLSPDAIREIRGAKIGFIFQDPMTSLNPLFTVEQQLVETMLANT
ELKPDEAYEKALELMEAVGIPQPELRIKQYPHQFSGGMRQRVVIAIALCCDPDLIIADEP
TTALDVSIQDQILQLIKKLCKERQVGCMLVTHDMGVVSNITDRVAVMYRGDLVEIGTTAQ
VLGAPKHPYTQSLISAVPRSDVKLVRFPLVSYIEAAEQPASIDLKNHWLGQQQEQREYQG
ALLQVKDVSLRFTTKDSMFPSRREYVQANNHVSFEINEGETFGLVGESGSGKSTIARVIT
GLYPPNEGQIIFEGIDLTALKSEKERRPFRRQMQMVFQNPYSSLNPRMKVADIIAEPIRF
HHLAENERQIQDIVGDLLDHVGLGRQAGLKYPHEFSGGQRQRISIARALATRPRLLICDE
PTSALDVSVQAQILNLLKDLQQELKLTMLFISHDLPVIRQMCDRIGVMQKGTLLEVAKTE
DLFLSPQHEYSRKLISLMPEFKGMSRAGLQIAEETATVNQSSN
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgtccctgctggaagtcagaaatttaagaattgaatatccctcacgttatggcgtgatg
gcggcagtgaaagatctgtcattctcgattgaaaagggcgagattctcggggtggtcggt
gagtctggtgcagggaagtcgactatcggtaatgccatcattgatttgttaagccctccg
ggccgcattgcccgcggtgatgtctttctgaatggtgaaaaaatttcgggtctgtcgccg
gatgcgatccgtgagatccggggtgccaaaatcggctttatctttcaggatccgatgaca
tcgctgaacccgctgttcacagtagaacaacagctggttgaaaccatgctggcgaatacc
gaactgaaaccggatgaagcgtatgaaaaagcgctggaattgatggaagcggttggtatt
ccgcaacctgaattacgcatcaaacagtatccgcatcagttttccggcggtatgcgtcag
cgcgtggtgattgccattgcactctgctgcgatccagatctgatcattgccgatgaacca
accacggcgctggatgtttcgattcaggatcaaatcctgcagctgattaaaaaactgtgt
aaggaacgtcaggttggctgcatgctggtcacccatgacatgggggtggtatctaatatc
actgatcgtgttgcagtgatgtatcggggggatctggttgagatcggtactacagcgcaa
gtgctgggtgcaccgaaacatccttatacccagagtctgatttctgcggtaccgcgttcg
gatgtgaaactggtgcgttttccgctggtttcctatattgaagccgctgagcaaccagct
tcaattgatctgaagaatcactggctgggacaacagcaggaacagcgggaatatcagggc
gccttgttgcaggtcaaagatgtcagcctgcgttttacaacgaaagattccatgttcccg
tcacgccgtgaatatgttcaggcgaacaatcacgtcagctttgaaatcaacgaaggtgaa
acctttggtctggtcggggagtccggctccggtaaatcgacgattgcccgggtgatcacc
ggtctgtatccgccaaatgaaggtcagatcatttttgaagggatcgatctgactgcactg
aaatcagaaaaagagcgtcgtccgttccgtcgtcagatgcagatggtatttcagaatcca
tactcttcgctgaatccgcgcatgaaggtcgccgatatcattgccgagccgatccgcttc
catcatctggcggaaaatgaacgccagatccaggatattgtgggtgacctgctggatcat
gtcgggctgggccgtcaggctggcttgaaatatccgcatgaattctccggtggtcagcgg
cagcgtatttcgattgcccgtgcgctggcgacgcgccctcgtttgctgatctgtgatgag
ccgacatccgcgctggatgtgtcggtgcaggcacagatccttaacctgctgaaagatctg
cagcaggagctcaaactcaccatgctgttcatcagtcacgatctgccggtgatccgtcag
atgtgtgaccggattggtgtgatgcaaaaaggaactttgctggaagtggcgaaaacggaa
gatctgttcctgtcaccacagcatgagtacagccgtaagctgatttcactgatgccggaa
tttaaaggtatgagccgcgctggtttgcagatcgcggaagagacggcaaccgtgaatcag
tcttcaaattaa

DBGET integrated database retrieval system