KEGG   Tolumonas auensis: Tola_2514
Entry
Tola_2514         CDS       T00904                                 

Definition
(GenBank) putative type IV pilin
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: N_methyl DUF1930
Other DBs
NCBI-ProteinID: ACQ94108
UniProt: C4LAD3
Position
complement(2745082..2747196)
AA seq 704 aa
MMYFKKQQGVALLEVLIAFVIVTVSVVALYQLQNKYIRNEIASSARLTALQIAESKLDDL
RTFGSLTVSSGVPSYDIIGNNTGGTIASGAISSSNANVDPFVYNLSWSVTPRAGSNDVTV
TVSWNDGNGPNNVKLTGSVVQTTRISADRLTNSSKAGNYKPVVKYTPVSNSDSGVVAVSL
GGAYMQETTKPLPDVSSNGGGVEVKFSTVTYNTNLNTQNLSDYSTVACDCTFESGYKSTA
LPATLITINGLLYWSAPTTPDLKSKSWGSPSGNKNATLCSVCCENHFDNVLGGEFKDYYN
RLNYPSSKYDSSLSMVTNGSYIDSCRLLRIDGMYKPMPDWNLVKLVVMDADFLKKPANLT
SYQNYIKYVVKSYVELQKKDSWPEHNPSLISDSTATSIQSFSQWLTTNYSIGGDTSTSIN
FDLTAATNPDRQIIARGIFVDIMPDDWVDLLDTDTAGSTYLQKVPFFDINMTLISQWSSS
NTAVATVASEPIQTLDLNKSYYGVYSRGYTAPISSGATVIKVTAFQGNSSVAAYQINNKS
AEMPVSAYDNSKAVTDTLTLSVDGTLAPETVIASGRLYCLDQTSITTGTGKDKVTNYSAT
ACLTNGNNKTFDLLNLSCTKSDININASPAYIPFTCTTTQGATLDISVTGIADGYSINPS
NPKTVVIPENAGSAVDVGCITVYQTILNSLPGIQFDSQGCVSSN
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgatgtattttaaaaaacagcaaggtgtagctttgctcgaagtgttaatagcctttgtt
attgtcactgtcagtgttgttgctctctatcaactacaaaataaatatattcgtaatgaa
attgcttccagtgcacgattaacagcactacaaattgctgaatcaaaattagatgatctt
agaacttttgggagtctgactgttagttctggtgtgccttcctatgatattattggcaat
aatactggtggtacaatcgcttcaggtgctatttcatccagtaatgcgaatgtggatcct
ttcgtttataatttgagttggagtgttacaccccgtgctggcagtaatgatgtgacagtc
actgtaagctggaatgatggtaatggtcccaataatgtcaaattgactggtagtgttgtt
cagacaacacgtattagtgcagatcgattaacaaacagtagtaaagcaggtaactataaa
ccagttgttaaatatacaccggtttcaaattctgatagtggggttgttgcagtcagtcta
ggtggggcatatatgcaggaaacaactaaaccgttacctgatgtatcatcaaatggtggt
ggagtggaagttaagttttctacagtaacctataatacaaatttgaatactcaaaattta
tctgattacagtacagtagcatgcgattgcacatttgagtctggttataaaagtactgct
ttacctgcaacattaataacaattaatggattattgtattggagtgctccaactacgcct
gacttgaaatcgaaatcatggggttctccatcaggtaataagaatgcaacattatgtagt
gtttgctgtgaaaatcattttgataatgttttaggtggtgaatttaaagattattataat
cgattaaattatccttcttcaaaatatgattcctcattaagtatggtaacaaacggtagt
tatattgattcatgccgtttattacgtatagatggtatgtataaaccaatgccagactgg
aatttagttaagttggtagtaatggatgctgattttttaaagaaaccagcaaacttgact
agttaccaaaattatattaaatatgttgtcaagtcatatgtagaactacaaaagaaagat
agttggcctgagcataatcctagtttaatttcagatagtacagcgacttcaattcaaagt
ttttcacaatggttgacgactaattattcaataggcggcgatactagcacaagtattaat
tttgatctgactgctgctacaaatccagatcggcaaattatagcgagaggcatatttgta
gacattatgccagatgactgggttgatttacttgatacagatacagcaggttccacttat
ttgcaaaaagtgccattttttgatattaatatgacattaatatctcaatggtcatcatct
aatactgcagttgcaactgttgctagtgaacctattcaaacccttgatctcaataagagt
tattatggcgtatattcacgaggatatacagcgcctatatcctctggtgcaactgtaatt
aaagtaacagcttttcaaggtaattcttccgtggctgcttaccagataaataataaatct
gcggaaatgcctgtgtcagcctatgataattcaaaggcagttactgatacgctaactctg
tctgtagacggaacgcttgctccggaaactgttattgcgagtggtagactttattgtttg
gatcaaacaagcataactacgggaacaggaaaggataaagttacaaactatagtgctact
gcatgccttactaacggtaataataagacttttgatttattgaatttaagttgtactaaa
tcagatataaacataaatgcatctccagcttatattccttttacttgtacaacaacccaa
ggtgctacattagacattagtgtgactggtatagcagatggttattcaattaatccatca
aatccaaaaacagtagttattccggaaaacgctgggtcagcagtagatgtaggttgtatc
actgtttatcaaacaattcttaattcactaccaggaatacaattcgactctcaaggatgt
gtatcttcaaattag

DBGET integrated database retrieval system