KEGG   Tolumonas auensis: Tola_2515
Entry
Tola_2515         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: PilX_N
Other DBs
NCBI-ProteinID: ACQ94109
UniProt: C4LAD4
Position
complement(2747210..2748406)
AA seq 398 aa
MTNFNKASGFITLTVVLIIVLLITALTLMTGKMLMGEQRTASNTMRYHEAKNAAQYGLDL
AAAQLMGNIDNRSAISSASATSPYYQVTFGTQINIPLGSRTIPVIPVQSIGSSGYSASTA
NAESQVTLREAFVAIPSISGTPAAPITVAAGSAIGGNLTVVANPNGGGPGVPLSVWSKVD
ITLADVGGSFVSCGLQEYTNANKDCTTYAYTDKTKIGTDVVKKDSNFPPNLLAYVFSGVQ
NMAELINDTKIMYPGDYKNRIGDGVISDSETVCNKLISAAQNASGRYIIKGGCDLKQAGV
IGSLSHPVQLVIWDGDLSFNSNTEVWGLIFAYSEDATATYSVKLVGTPVLHGIFVSNYQT
QFNGAGNFNIVYDPAVVTNMNNLSQPITAIVPGSWHDW
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgaccaattttaacaaggcatcaggttttataaccttaactgttgtgctaattattgtt
ttgttgattaccgccctgacgttgatgactggaaaaatgttgatgggcgaacaacgcaca
gcatcaaatacaatgcgttatcatgaagcaaaaaatgcggcacaatatggactagatttg
gccgctgctcaattaatgggtaatattgataatcgaagtgctatatcttcggcatcagca
acctcgccttattaccaagttacatttggtacacaaattaatattcctctcggaagtaga
actattcctgttattcctgtgcagtctatcggctcatctggttattctgccagcactgca
aatgcagagtcacaggtaacattaagagaagcatttgtagcaattccttcaatttccgga
actcccgctgcaccaatcaccgtcgctgcagggtctgcaatagggggaaatctcacggtc
gttgctaatcctaatggtggcggtcctggtgtaccattgtctgtctggtcaaaggttgat
ataactttggctgatgtaggtggttcttttgtttcctgtggtttacaagagtataccaat
gcgaacaaagattgtacgacttatgcgtatactgataaaacaaaaataggaacagatgta
gtcaagaaagattccaatttcccacctaatttgttggcctatgttttttctggggttcaa
aatatggcggaattaattaatgatactaaaataatgtatcctggtgactataagaataga
atcggtgatggagttatatctgattctgagactgtatgtaacaaattaatttctgcagca
caaaatgcatcaggacgatatatcatcaaaggtggttgtgatttaaaacaggcaggagta
attggctcgctgtctcatccagttcaattggttatttgggatggtgatttatcttttaat
tccaacactgaggtgtggggacttatttttgcttactcggaagatgcaactgctacatat
agcgtcaaattggtcggcactcctgtattacatggtattttcgtgtcaaattatcaaacc
cagtttaatggtgctggtaatttcaacattgtttatgatccagcagtagtaacaaatatg
aataatctttctcaacctattactgctattgttcctggcagttggcatgattggtaa

DBGET integrated database retrieval system