KEGG   Tolumonas auensis: Tola_2516
Entry
Tola_2516         CDS       T00904                                 

Definition
(GenBank) putative type IV pilin
  KO
K02672  type IV pilus assembly protein PilW
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tau02044]
    Tola_2516
   02035 Bacterial motility proteins [BR:tau02035]
    Tola_2516
Secretion system [BR:tau02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Tola_2516
Bacterial motility proteins [BR:tau02035]
 Pilus system
  Pilus assembly proteins
   Tola_2516
SSDB
Motif
Pfam: N_methyl
Other DBs
NCBI-ProteinID: ACQ94110
UniProt: C4LAD5
Position
complement(2748393..2749127)
AA seq 244 aa
MPIFLKRSGTIQKSKGFSLIELMVAMVIGLFVAAIMATMYVSIIRANSTTVQLSRLNMDM
QSALDIIARDIQRTGYASGAEAALERDSAGNPTSSAVSSAVHTAMFSAYASDGSALDLQN
NCVLLRYDANDDGSITGGANPPEIIAYSYVSGASSVVYQEFNTAGSQSCTVDNTWQVLAG
GDGHLDITGLTFTLDPVSGAFATSGAYNTTGQRFVRIRIAGRSSTNNDIQLRLDRRVRLQ
NDQF
NT seq 735 nt   +upstreamnt  +downstreamnt
atgcccatcttcttaaaaagaagcggaacaatacagaaatcgaaaggtttctcattgatt
gaactaatggttgccatggtaatcggcttatttgtagccgctattatggcaaccatgtat
gtcagcatcattcgtgctaattcgaccacagtgcagctgtctcgtctgaatatggatatg
cagtctgctctggacatcattgcccgggatatacagcgaaccgggtatgccagtggagct
gaagctgcgttggaaagagatagtgcagggaatccaaccagtagtgctgtttccagtgcg
gttcatactgctatgttttctgcttatgcgtcagatggttcagcactagacttacagaat
aactgcgttttgttacgttatgatgcaaatgatgatggctctattactggcggtgcgaac
cctccggaaatcattgcctacagttatgtttctggtgccagctcagttgtatatcaggaa
tttaacacagcaggttctcaatcgtgcactgtagataatacatggcaggtattagctggt
ggagatggtcatctggatattactggcttaacgtttaccctagatcctgtgagtggtgca
ttcgctacaagcggtgcttacaataccacggggcagcgttttgtccggatacgaattgca
ggcagaagtagcacaaacaatgacattcagctgaggcttgatcgtagagtgaggttgcaa
aatgaccaattttaa

DBGET integrated database retrieval system