KEGG   Tolumonas auensis: Tola_2517
Entry
Tola_2517         CDS       T00904                                 

Definition
(GenBank) putative type IV pilin
  KO
K08084  type IV fimbrial biogenesis protein FimT
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tau02044]
    Tola_2517
Secretion system [BR:tau02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Tola_2517
SSDB
Motif
Pfam: GspH N_methyl
Other DBs
NCBI-ProteinID: ACQ94111
UniProt: C4LAD6
Position
complement(2749112..2749648)
AA seq 178 aa
MRSRISGFTLIELIITILVMTILLGIGVPSYMQFKEDNTLQGAAQALYSDIQFARSEAIK
RNTDDVVVHLFQTGNNWCYQVSDNPDCDDCGDSDCDIHGDGILRGVIWSGYPNVSMASNT
SSVTIQSQRAVMNSNRIIFSYGQTGKEIEVRTTPLGRVFMCTPVGKAGLTGVDKCPSS
NT seq 537 nt   +upstreamnt  +downstreamnt
gtgagatcgcgaatttccggttttaccctgatagagttgatcatcaccatattggtaatg
acgattcttttgggtattggtgtaccgagctatatgcaatttaaggaagataacaccttg
cagggagctgcccaagcgctctattcagatattcaatttgcccgtagcgaagcgattaag
cgcaatacagatgatgttgtcgttcatttattccaaacaggtaacaactggtgttatcag
gtttctgataatccagattgtgacgattgcggagatagtgattgtgatatccatggtgat
ggtatattgcgtggtgtcatttggagtggctatcctaatgttagcatggccagcaatacc
tccagcgttacgattcagtctcaaagagcggtaatgaatagcaaccggatcatattttct
tatggtcagactggtaaagaaatagaagtgagaacaacgcctctgggacgcgttttcatg
tgtacacctgttggtaaagccggtttaacgggagtggataaatgcccatcttcttaa

DBGET integrated database retrieval system