KEGG   Tolumonas auensis: Tola_2518
Entry
Tola_2518         CDS       T00904                                 

Definition
(GenBank) type IV pilin
  KO
K02655  type IV pilus assembly protein PilE
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tau02044]
    Tola_2518
   02035 Bacterial motility proteins [BR:tau02035]
    Tola_2518
Secretion system [BR:tau02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Tola_2518
Bacterial motility proteins [BR:tau02035]
 Pilus system
  Pilus assembly proteins
   Tola_2518
SSDB
Motif
Pfam: ComP_DUS N_methyl
Other DBs
NCBI-ProteinID: ACQ94112
UniProt: C4LAD7
Position
2749743..2750129
AA seq 128 aa
MKNNSRGFTLLELMIVVAIVAILATIAYPSYQGFVLRSHRAEAIEGLLSAQLRQEEWRVK
NGSYTSTMSDLGSPTSTYYAFTATASSSGVPTYTLTATASGSQTADTDCPTLTITNADVK
GPSTSCWE
NT seq 387 nt   +upstreamnt  +downstreamnt
atgaaaaataattccagaggcttcaccttgctggaacttatgatagtcgtagctatagtt
gccattctggctaccatagcctaccccagttatcagggttttgtgttacgttcacacaga
gctgaggccattgaaggtttgttatcagctcaattacgccaggaagaatggcgggttaaa
aatggttcatataccagcactatgagcgatcttggtagtccaaccagtacttactatgcc
ttcactgccaccgccagcagcagtggtgtaccaacctataccttgacagctactgcttct
ggtagccaaacagccgataccgactgcccaacattgacgataacaaatgcagatgtaaaa
ggtccgtccacttcctgctgggaataa

DBGET integrated database retrieval system