KEGG   Tolumonas auensis: Tola_2519
Entry
Tola_2519         CDS       T00904                                 

Definition
(GenBank) Phosphatidylglycerophosphatase
  KO
K01095  phosphatidylglycerophosphatase A [EC:3.1.3.27]
Organism
tau  Tolumonas auensis
Pathway
tau00564  Glycerophospholipid metabolism
tau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Tola_2519
Enzymes [BR:tau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.27  phosphatidylglycerophosphatase
     Tola_2519
SSDB
Motif
Pfam: PgpA Colicin_V
Other DBs
NCBI-ProteinID: ACQ94113
UniProt: C4LAD8
Position
complement(2750185..2750688)
AA seq 167 aa
MAKLEKHHKSYDALQRLNWRNPLHWLATGFGSGLSPVAPGTFGTLAAIPFYWLMMDLSLP
VYITITVIAAIAGIWICQSATDAIGQSDHGSIVWDEFVGFWITMIAAPKGLLWLLAGFLL
FRLFDILKPWPIRWLDRYVKGGLGIMIDDVLAGVFGLVIMQVLAYFF
NT seq 504 nt   +upstreamnt  +downstreamnt
atggcgaagctggaaaaacatcataaaagctatgatgcactgcaacgactgaactggcgg
aacccgctgcattggctggcgaccggttttggttcgggactatcaccagttgcgccaggc
accttcggcacactggctgcgatcccgttttactggctgatgatggatttatcgttaccg
gtctatatcacgatcaccgtgattgctgccatcgcaggtatctggatctgccagtcagcg
acagatgccatcggccaatcggatcatggttcaatcgtctgggatgaatttgttggtttc
tggatcaccatgatcgcagccccgaaaggcttgctctggttactggctggattcttactc
ttccgcctgttcgatattctcaagccatggcccatccgctggctggatcgttatgtcaaa
ggcggtttaggtatcatgattgatgatgtgctggcaggggtatttgggctggtgataatg
caagtgctggcttactttttttga

DBGET integrated database retrieval system