KEGG   Tolumonas auensis: Tola_2520
Entry
Tola_2520         CDS       T00904                                 

Definition
(GenBank) thiamine-monophosphate kinase
  KO
K00946  thiamine-monophosphate kinase [EC:2.7.4.16]
Organism
tau  Tolumonas auensis
Pathway
tau00730  Thiamine metabolism
tau01100  Metabolic pathways
Module
tau_M00127  Thiamine biosynthesis, prokaryotes, AIR (+ DXP/tyrosine) => TMP/TPP
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Tola_2520
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.16  thiamine-phosphate kinase
     Tola_2520
SSDB
Motif
Pfam: AIRS AIRS_C
Other DBs
NCBI-ProteinID: ACQ94114
UniProt: C4LAD9
Position
complement(2750663..2751649)
AA seq 328 aa
MGEFELIQHYFAAQAAARADVELGIGDDCALLNVPVGECLAVSTDTLVSDVHFFADVDPV
ALGHKALAVNLSDLAAMGAQPRWISLALTLPKADDVWLTGFTQGFHALAVKHNVALIGGD
TTRGPLSITISAKGTVPAAQALRRSGAKAGDAIYVSGSLGAAALAVQQRIHNLPINSDAL
RDCSFRMDYPQPRCELGLALRGIATSALDLSDGLSGDLMHILRASGVAAEIELTNLPIAS
AVQRSVTPEQALQLALGGGDDYELCFTVPAGHETAISELAVALDLPLTRIGTITTGEPQI
IWYHQGKAVELHINGWEHFHHGEAGKTS
NT seq 987 nt   +upstreamnt  +downstreamnt
gtgggtgaatttgaactgatccaacattattttgccgctcaggctgcggcaagagctgat
gtagaattaggcatcggtgatgactgtgcgctattgaatgtaccggttggtgaatgtctg
gccgtcagtacggatacattggtcagtgatgtgcatttttttgctgatgttgatccggtc
gcattagggcataaagcgctggcggttaatctttctgatctcgctgcgatgggcgcacaa
ccgcgctggatctctctggctctcaccttacctaaagccgatgatgtctggctgacgggt
tttactcaggggtttcatgcactggcggtgaaacacaatgtcgcactcattggtggcgac
actacccgcggaccgctttctatcaccatttctgccaagggaaccgtgcccgctgctcag
gcgttacgtcgttccggcgctaaggcgggagatgccatttacgtcagtggcagtttaggt
gcggcagcattggccgtgcagcagcgtatacacaatttacccataaacagtgatgcattg
cgtgactgttcattccgtatggattacccacaaccgcgttgtgaactgggtctggcactg
cgtggtatcgcaaccagtgccctggatctgtctgacggactttccggcgatttaatgcat
atcctgcgggcatccggggtggcagctgaaattgagctgactaatctgccaattgcgtcg
gcagttcagcggagtgtgacaccggagcaggcactgcaattagcactgggtggcggggat
gattatgaactctgttttaccgtacctgccgggcatgaaacggctatcagcgagctggct
gttgcgctggatttaccactgacccgcatcggtactatcacgaccggtgagccgcagata
atctggtatcatcagggcaaagcggtcgaattacatattaatggctgggagcattttcac
catggcgaagctggaaaaacatcataa

DBGET integrated database retrieval system