KEGG   Tolumonas auensis: Tola_2521
Entry
Tola_2521         CDS       T00904                                 

Definition
(GenBank) NusB antitermination factor
  KO
K03625  transcription antitermination protein NusB
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:tau03021]
    Tola_2521
   03009 Ribosome biogenesis [BR:tau03009]
    Tola_2521
Transcription machinery [BR:tau03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     Tola_2521
Ribosome biogenesis [BR:tau03009]
 Prokaryotic type
  rRNA transcription factors
   Tola_2521
SSDB
Motif
Pfam: NusB
Other DBs
NCBI-ProteinID: ACQ94115
UniProt: C4LAE0
Position
complement(2751743..2752159)
AA seq 138 aa
MKPAERRKARHLALQAIYQWQLAKDNVADIVEQFKLEQPTKGVDLPYFELLLTGVVNNVT
NLDATFSPFLSRKLDDLDQIDKGVLRLACYELTYCKDVPYKVVINEAIELAKAFATDDSH
KFVNGVLDKVVKQMGLRQ
NT seq 417 nt   +upstreamnt  +downstreamnt
ttgaaacctgctgaacgccgtaaggcgcgccatcttgctctgcaagccatttatcagtgg
caactggctaaagacaacgtggctgatattgttgaacagttcaaattggaacagccaacg
aaaggcgtcgatctgccttattttgagctgttgctgaccggtgttgtcaacaatgtaact
aatctggacgctactttctcaccattcctgtcgcgtaaactcgacgatctggatcagatt
gataaaggtgtgttgcgtctggcttgttatgagctgacctattgtaaagatgtgccatat
aaagtcgtgatcaatgaagcgattgagttggcaaaagcgttcgccacagatgatagtcat
aagtttgtgaatggcgtattagataaagtcgtaaaacagatggggctgcgtcagtaa

DBGET integrated database retrieval system