KEGG   Tolumonas auensis: Tola_2523
Entry
Tola_2523         CDS       T00904                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
tau  Tolumonas auensis
Pathway
tau00740  Riboflavin metabolism
tau00790  Folate biosynthesis
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
Module
tau_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Tola_2523
   00790 Folate biosynthesis
    Tola_2523
Enzymes [BR:tau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Tola_2523
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Tola_2523
SSDB
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Other DBs
NCBI-ProteinID: ACQ94117
UniProt: C4LAE2
Position
complement(2752735..2753841)
AA seq 368 aa
MAISKIEEIIEDFRQGKMVILMDDEDRENEGDILMAASMVRPEDINFMAKYGRGLICLTL
SKARCQQLNLPLMVDKNEAQFSTAFTVSIEAAEGVTTGISAADRARTVQAAVAADARPSD
VVQPGHIFPLMAQDGGVLTRNGHTEAGCDLARLAGLEPAAVIVEVLNEDGTMARRPDLEK
FAAEHGIKLGTIADLIEYRNQHETTILKIAQCHMPTEYGEFELTTFRDTIDNQLHFALSK
PQKDPSKPVLVRVHLHDYLNDVLNSQRGNLRSWPLDKAMNRINDEGGIVVIIGHEDSQQE
LLARIEHYAAVDSGQTTEICKPKPASRRVGVGSQILKAMGVKQMRLLSSPKRYVLSGFGL
EVVEYISE
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggctatcagtaagattgaagagattattgaagattttcgtcagggcaaaatggtcatt
ctgatggatgacgaagatcgggaaaatgaaggtgacattctgatggctgcatcgatggtg
cgtccggaagatattaacttcatggcaaaatacggtcgcggattgatctgtctgacctta
tccaaggcccgttgccagcagttgaacctgccattgatggtcgataaaaacgaagcgcag
ttttctaccgcattcactgtttccattgaagcagctgaaggggttactaccggcatttca
gccgccgatcgcgcccgtactgtacaggccgccgtggcagcagatgccagaccaagtgat
gtggtacaaccggggcatatcttcccgctgatggcgcaggatggcggtgttctgactcgt
aatgggcatacagaagccggttgtgatctggctcgtctggctggtctcgaaccggcagct
gtgatcgttgaggtcctgaatgaagacggtaccatggcccgtcgtccggatctggagaaa
tttgcggcagagcatggcatcaaattaggtactattgccgatttaattgaataccgtaat
cagcatgaaaccacgatcctgaagatcgcacagtgccatatgccaaccgaatatggtgaa
ttcgagctgactacattccgtgataccattgataatcagttacattttgccttaagcaaa
ccgcaaaaagacccgtcaaagccagtattggtgcgggtacatttgcatgattatctgaat
gacgtcctgaacagtcagcgcggaaatctgcgtagctggccgctggataaagccatgaat
cgcatcaatgatgaaggcggtatcgtggtgatcattggacatgaagacagtcagcaggaa
ttactggcgcgtattgaacattatgcggcagtagattcgggccagaccacagagatctgt
aagccgaaaccggcttcccgccgtgttggcgtgggctctcagatcctgaaagcgatgggc
gtgaaacagatgcgtctgctcagctcaccgaaacgttatgtactgtcaggctttggtctg
gaagtcgtggaatacatcagtgaataa

DBGET integrated database retrieval system