KEGG   Tolumonas auensis: Tola_2524
Entry
Tola_2524         CDS       T00904                                 

Definition
(GenBank) riboflavin synthase, alpha subunit
  KO
K00793  riboflavin synthase [EC:2.5.1.9]
Organism
tau  Tolumonas auensis
Pathway
tau00740  Riboflavin metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
Module
tau_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Tola_2524
Enzymes [BR:tau01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.9  riboflavin synthase
     Tola_2524
SSDB
Motif
Pfam: Lum_binding
Other DBs
NCBI-ProteinID: ACQ94118
UniProt: C4LAE3
Position
complement(2753859..2754518)
AA seq 219 aa
MFTGIIEAVGTLAALQPKGEDISVRVKSGKLDLSDVKLGDSIATNGVCLTVVELTGDGYV
ADLSLETLQRSSFVYYQAGQKVNLERALTPDTRLGGHLVSGHVDGVGEIVSVKPLGRAKE
YWIKAPDELAKYIAEKGSITVDGISLTVNAIDGARFKLTIVPHTSGETTVDEWQAGVKVN
LEVDVIARYLERLLLGDKAAQSSQSNITMEMLAQNGFLR
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtttaccggaattattgaagctgttggtacgctggcagcattacagccgaaaggtgaa
gatatttcagtccgggtaaaaagtggcaagctggatctttctgatgtgaaattaggtgat
tcgattgcaactaatggcgtctgcctgaccgttgttgaattaacgggggatggttatgtc
gctgatttgtcgttagaaacactacaacgtagtagctttgtttactatcaggcaggacaa
aaagtgaatctggaacgtgcgctgacacccgatacccgtttaggcggtcatctggtttcc
gggcatgtggatggggtcggcgaaattgtttcagtgaaaccgttgggccgggctaaagag
tattggatcaaggcgccggatgagctggcgaaatacattgcagaaaagggttcaatcacc
gtcgacggtattagtctgacggtgaatgctatcgatggtgctcgtttcaaactgaccatt
gtgccgcataccagcggtgaaaccacggtggatgaatggcaggccggtgtgaaagttaat
ctggaagtggacgttattgcccgctatctggaacggttgttgctgggcgataaagcggcg
cagtcatcacagagcaatatcaccatggaaatgctggcacaaaacggttttctgcgataa

DBGET integrated database retrieval system