KEGG   Tolumonas auensis: Tola_2525
Entry
Tola_2525         CDS       T00904                                 

Definition
(GenBank) riboflavin biosynthesis protein RibD
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
tau  Tolumonas auensis
Pathway
tau00740  Riboflavin metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau02024  Quorum sensing
Module
tau_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Tola_2525
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Tola_2525
Enzymes [BR:tau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     Tola_2525
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.26  diaminohydroxyphosphoribosylaminopyrimidine deaminase
     Tola_2525
SSDB
Motif
Pfam: RibD_C dCMP_cyt_deam_1 MafB19-deam Inv-AAD
Other DBs
NCBI-ProteinID: ACQ94119
UniProt: C4LAE4
Position
complement(2754528..2755640)
AA seq 370 aa
MFSAEDHLYMSRALQLAEQGRFTTSPNPNVGCVIVADGRIVGEGFHLRAGEPHAEVHALR
MAGDKARGATAYVTLEPCSHFGRTPPCADALVNAGVARVVAAMEDPNPQVSGRGMRRLAD
AGVTIQTGLLQAQAEALNPGFIKRMRHGLPYVRLKLAASLDGRTALANGQSQWITSPAAR
ADVQRWRAQSSAILTGADTVLTDDPSLNVRWEQLPLSVQQCYAKDNVRQPIRIIIDSRQR
IVPSAHLFSIPGEIWLARHKEQGQWPEQVQQLSTPLADSGKLDLVQLMQTLAQRHINDIW
VEAGASLAGALMSAGLVDELMVYLAPKLMGNPARGLVNLPEFKHMSEVNEWQWQDVRKVG
NDLRLTLRPH
NT seq 1113 nt   +upstreamnt  +downstreamnt
gtgttttctgccgaagatcatctttatatgagccgcgctctgcaactggcagagcagggg
cgttttactacctctccgaacccgaatgtaggctgtgtcattgtggctgatggccggatc
gtcggcgaaggttttcatctgcgcgccggtgaaccgcatgcggaagtgcacgcactgcgt
atggctggtgataaagcccgtggtgcgaccgcgtatgttactttagaaccctgctcacat
tttggtcgtacaccgccctgtgctgatgcgctggtcaatgccggtgttgcccgtgtcgtt
gcggcgatggaagatccgaatccacaggtatccggacgcggcatgcgacgtctggctgat
gccggtgtaacaatccagacgggtttgttacaggcacaggcagaggcattgaaccctggc
tttatcaagcgtatgcggcatggcttgccttatgtgcgtctgaagctggcagccagtctt
gatggtcgcaccgcactcgcgaatggccaaagtcagtggatcacatctcctgcagctcgt
gctgatgtacaacgctggcgcgcgcaaagcagcgcaattctgactggtgctgataccgtt
ttgaccgatgatccctcactgaatgtacgttgggaacaactgcctttatctgtgcaacag
tgttatgcaaaagacaatgttcgtcagccaatacgcattattattgattcccggcaacgc
attgttccgtcagcacacttattttccattccgggagagatttggctggctcgccacaaa
gagcaggggcaatggccggaacaggttcagcagctgagcacgcctctggcggatagcggt
aaactggatctggtccaactgatgcaaacattagcgcaacgccatattaatgatatctgg
gtggaagcgggcgcttctctggcgggcgcattaatgagtgccggactggtcgatgaactg
atggtttatctcgcacccaagttgatgggaaaccctgcccgtggtctggttaatctgcct
gaattcaaacatatgtcggaagttaatgaatggcagtggcaggatgtacgtaaagtcggc
aatgatctgcgattgaccttacgtccgcattaa

DBGET integrated database retrieval system