KEGG   Tolumonas auensis: Tola_2526
Entry
Tola_2526         CDS       T00904                                 

Definition
(GenBank) ATP-cone domain protein
  KO
K07738  transcriptional repressor NrdR
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tau03000]
    Tola_2526
Transcription factors [BR:tau03000]
 Prokaryotic type
  Other transcription factors
   Others
    Tola_2526
SSDB
Motif
Pfam: ATP-cone
Other DBs
NCBI-ProteinID: ACQ94120
UniProt: C4LAE5
Position
complement(2755641..2756090)
AA seq 149 aa
MHCPFCNADDTKVIDSRLVADGHQVRRRRECLVCHERFTTFEMAELVMPRVIKSNGVREP
FNEDKLRNGIQRALEKRPVSTELIEQSINRIKSNLRATGEREIMSKIIGNLVMEELKLLD
KVAYIRFASVYRSFEDIREFGEEIARLEK
NT seq 450 nt   +upstreamnt  +downstreamnt
atgcattgtccattttgtaatgccgacgacacgaaagttattgattcgcgcctggtggcg
gatgggcatcaggtgcgccgtcggcgggaatgtctggtttgccatgagcgttttactacg
ttcgagatggcagagctggtcatgccacgggtgataaaaagtaacggtgttcgcgagcca
tttaacgaagataaattacgtaatggtattcagcgcgcactggaaaagcgtccggtcagc
accgagttgatcgaacaaagtattaaccggatcaaatcgaatctgcgggcaaccggtgaa
cgggaaatcatgtccaagatcatcggtaatctggtgatggaagagctgaagctgctggat
aaagtcgcttacatccgttttgcctctgtttatcgcagttttgaagatatccgcgaattt
ggtgaagagatcgcacgtctggagaaataa

DBGET integrated database retrieval system