KEGG   Tolumonas auensis: Tola_2527
Entry
Tola_2527         CDS       T00904                                 

Definition
(GenBank) Glycine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
tau  Tolumonas auensis
Pathway
tau00260  Glycine, serine and threonine metabolism
tau00460  Cyanoamino acid metabolism
tau00630  Glyoxylate and dicarboxylate metabolism
tau00670  One carbon pool by folate
tau00680  Methane metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
tau01200  Carbon metabolism
tau01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Tola_2527
  09102 Energy metabolism
   00680 Methane metabolism
    Tola_2527
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tola_2527
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Tola_2527
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Tola_2527
Enzymes [BR:tau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     Tola_2527
SSDB
Motif
Pfam: SHMT Aminotran_1_2 Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 OKR_DC_1 Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: ACQ94121
UniProt: C4LAE6
Position
complement(2756204..2757457)
AA seq 417 aa
MLKRDMNIADYDPELWASIVEETQRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYP
GKRYYGGCEFVDKTETLAIERAKALFGAVYANVQPHSGSQANAAVYMALLKPGDTVLGMN
LAHGGHLTHGSPVNFSGKLYNIVPYGIDASGKIDYVELERLALEHKPKMVLGGFSAYSGV
VDWAKMREIADKVGAYLFVDMAHVAGLVAAGVYPNPVPHAHVVTSTTHKTLAGPRGGLIL
SAVNDEELHKKLNSAVFPGTQGGPLMHVIAGKAVAFKEAMEPEFKAYQQQVVKNSKAMVE
VFLARGYKIVSGGTENHLFLVDFTDRELTGKEADAALGLANITVNKNSVPNDPRSPFVTS
GIRIGSPSITRRGFKEAEAKELAGWICDVLDNRTDEAVIAATRAKVLDICKRLPVYA
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgctgaagcgtgatatgaacatcgccgattatgatccggagctgtgggcttcaattgtg
gaggaaacacagcgtcaggaagagcatatcgaactgattgcttctgaaaactacaccagc
ccacgtgtaatgcaagcacagggatcacaattaaccaataaatatgccgaaggttatccg
ggcaaacgttattacggtggttgtgagtttgttgataagactgaaactctggctattgaa
cgagctaaagcactgttcggtgctgtctatgctaacgtgcagccacactctggttctcag
gcaaacgctgctgtttatatggcgctgctgaaaccgggcgataccgttctgggtatgaac
ctggcacacggtggtcacctgactcacggttcaccggttaacttctccggtaagctgtat
aacatcgttccctacggtattgatgccagcggtaaaattgattacgtcgaactggagcgt
ctggctctggaacacaaaccaaaaatggttctgggtggtttctcggcttactcaggtgtt
gttgactgggcaaaaatgcgtgaaatcgctgacaaagtaggtgcttacctgtttgttgat
atggcgcacgtagctggtctggttgcagccggtgtatatccaaacccggttccgcatgcg
catgtagtgacttcaactacccataagacactggctggtccacgtggtggtctgatcctg
tctgcagtaaatgatgaagaactgcataagaagctgaactctgctgtattccctggcact
cagggtggtccgctgatgcatgttatcgctggtaaagcggtagcgttcaaagaagctatg
gagccggaattcaaggcttatcagcagcaggtagtgaaaaactccaaagcaatggtagaa
gtattcctggcccgcggttacaaaatcgtttccggcggtactgaaaaccacctgttcctg
gttgatttcactgatcgtgaattgaccggtaaagaagccgatgctgcactgggtctggca
aacattactgtgaacaaaaactcagtaccaaacgacccacgttcaccatttgtgacttcc
ggtatccgtatcggttctccatccatcactcgccgtggctttaaagaagctgaagcgaaa
gaactggctggctggatctgtgacgtgctggacaaccgcactgacgaagccgttattgct
gctacccgcgcgaaagtgctggatatctgcaaacgtctgccagtatacgcataa

DBGET integrated database retrieval system