KEGG   Tolumonas auensis: Tola_2528
Entry
Tola_2528         CDS       T00904                                 

Definition
(GenBank) 3-dehydroquinate dehydratase, type II
  KO
K03786  3-dehydroquinate dehydratase II [EC:4.2.1.10]
Organism
tau  Tolumonas auensis
Pathway
tau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01230  Biosynthesis of amino acids
Module
tau_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tola_2528
Enzymes [BR:tau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.10  3-dehydroquinate dehydratase
     Tola_2528
SSDB
Motif
Pfam: DHquinase_II
Other DBs
NCBI-ProteinID: ACQ94122
UniProt: C4LAE7
Position
2757771..2758229
AA seq 152 aa
MTAKFRILVLNGPNLNLLGKREPGIYGAATLDDIVGRLQQLAAELDVELTHKQSNAEYEL
VDTIHQAMGTVDFILINPAAFTHTSVAIRDALLGVAIPFIEIHLSNVHAREPFRHHSFLS
DVAKGVICGLGADGYEFALTAAVRHLERSSNN
NT seq 459 nt   +upstreamnt  +downstreamnt
atgactgcaaagttccgcattttagtgcttaacggccctaacctgaatttgctgggaaaa
cgtgagccaggcatctacggcgccgcaacacttgacgacattgtcggtcgtttgcaacaa
ctggctgctgagctggatgttgaactgacccataaacaatccaacgctgaatatgaactg
gtcgataccattcatcaggcgatggggacagtcgattttatccttatcaatccggcagcc
ttcactcataccagcgttgcgatccgcgatgctttactgggtgttgccattccatttatc
gaaattcatttatcgaatgttcatgcccgtgaacctttccgtcatcactcctttttatct
gatgtagccaaaggcgtgatctgtggtctgggagctgatgggtatgaattcgcacttacc
gcggccgtccgtcatctggaacggtcatccaataattga

DBGET integrated database retrieval system