KEGG   Tolumonas auensis: Tola_2529
Entry
Tola_2529         CDS       T00904                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxyl carrier protein
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
tau  Tolumonas auensis
Pathway
tau00061  Fatty acid biosynthesis
tau00620  Pyruvate metabolism
tau00640  Propanoate metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
tau01200  Carbon metabolism
tau01212  Fatty acid metabolism
Module
tau_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tola_2529
   00640 Propanoate metabolism
    Tola_2529
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Tola_2529
SSDB
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H
Other DBs
NCBI-ProteinID: ACQ94123
UniProt: C4LAE8
Position
2758261..2758707
AA seq 148 aa
MDIRKIKKLIELVEESGIAELEITEGEESVRISRAVSGQVAPMINFAPQAAPVAAAAPVA
NTAAPAAEAVSGYTLRSPMVGTFYRSSGPDAKAFVEVGQSVKVGDPLCIVEAMKMMNQIQ
SDKAGVVKSILVENGDTVEFDQPLFIIE
NT seq 447 nt   +upstreamnt  +downstreamnt
atggacatccgtaaaatcaaaaaactgatcgagctggttgaagaatccggcattgctgaa
ctggaaatcaccgaaggtgaagaatcggttcgcatcagtcgcgcagtcagcggtcaggtt
gcaccaatgatcaatttcgcaccacaagcagcgcctgttgccgcagcagcgccggtagcg
aataccgcagcaccagccgcagaagcagtaagtggttataccctgcgctctccgatggtt
ggtactttctaccgttcttcaggcccggatgcaaaagcatttgttgaagttggccagtcg
gtaaaagtgggcgatccactgtgtatcgtagaagctatgaagatgatgaaccagatccag
tctgacaaagctggtgtggtaaaaagcattctggttgaaaacggcgataccgttgagttt
gatcagcctctgtttatcatcgaataa

DBGET integrated database retrieval system