KEGG   Tolumonas auensis: Tola_2530
Entry
Tola_2530         CDS       T00904                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
tau  Tolumonas auensis
Pathway
tau00061  Fatty acid biosynthesis
tau00620  Pyruvate metabolism
tau00640  Propanoate metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
tau01200  Carbon metabolism
tau01212  Fatty acid metabolism
Module
tau_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tola_2530
   00640 Propanoate metabolism
    Tola_2530
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Tola_2530
Enzymes [BR:tau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Tola_2530
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Tola_2530
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp_3 ATP-grasp GARS_A ATP-grasp_4
Other DBs
NCBI-ProteinID: ACQ94124
UniProt: C4LAE9
Position
2758719..2760059
AA seq 446 aa
MLDKIVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVKLADETICIGKPSAKDSY
LNVPSIIAAAEVTGAVAIHPGYGFLSENADFAEQVEKSGFIFVGPKAETIRLMGDKVSAI
EAMKKAGVPCVPGSGGPIGEDAKQNAAIAKRIGYPVIIKAAGGGGGRGMRVVRNEEELQN
SVALTKSEAGQFFGNDMVYMEKYLENPRHIEIQVLADGQGNAIYLGERDCSMQRRHQKVL
EEAPAPGITEDMRRYIGERCVRACIEINYRGAGTFEFLYENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLKIAAGQPLSIKQDEIHIRGHAIECRINAEDPQTFLPAPGKIQWFHAP
GGLGVRWDSHIYSGYTVPPHYDSMIGKLICYGENRDIAIARMRQALDEIVVEGIKTNIPL
HKEILRDENFHSGGTNIHYLHKKLGL
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgttggataaaattgtcatcgctaaccgtggtgaaatagctctgcgcatcctgcgtgcg
tgtaaagagctcggcatcaaaacggtagcagtgcattccaccgcagaccgcgatctgaaa
cacgttaagctggcagatgaaaccatttgcattggtaaaccgtccgcgaaagattcttat
ctgaacgtgccttcgattattgcagcagcggaagtgaccggcgcagtggctatccacccc
ggttacggcttcttgtctgaaaatgcagactttgcagaacaggtagaaaagtccggcttt
attttcgtcggcccgaaagctgaaactattcgtctgatgggcgataaagtgtcagcaatt
gaagcgatgaaaaaagcaggcgtgccgtgtgtacctggttcaggtggcccgattggcgaa
gatgccaaacaaaacgccgccattgcgaaacgtatcggctatccggtgatcatcaaggct
gccggtggtggtggtggtcgcggtatgcgtgttgtacgcaacgaagaagaactgcaaaac
tctgttgcgctgactaagtcagaagcgggtcagttctttggcaacgacatggtctacatg
gaaaaatatctggaaaatcctcgtcatatcgagatccaggtattagccgatggtcagggc
aatgccatctatctgggtgaacgtgattgctctatgcaacgccgtcaccagaaagtatta
gaagaagcgccagcaccaggcattacggaagatatgcgtcgttacatcggcgaacgttgt
gttcgtgcttgtatcgagattaactaccgtggcgccggcacgtttgaattcctgtatgaa
aacggtgagttctatttcatcgaaatgaacacccgtattcaggtagaacatccggtgaca
gaaatgatcacgggtgtggatctgatcaaggagcagctgaaaattgctgcgggtcagcca
ctgtctatcaaacaggatgaaattcatattcgcggtcatgcgattgaatgccgtatcaac
gcagaagatccacaaactttcctgccagctccgggcaagatccagtggttccatgcaccg
ggtggtttaggcgtccgctgggattctcatatctattccggctataccgtaccgccgcat
tacgattcaatgatcgggaaactgatctgctacggtgaaaaccgggatatcgcaatcgcg
cgtatgcgtcaggcactggatgagattgtggtggaagggatcaaaaccaacattccgctg
cataaagagatcctgcgggacgaaaacttccacagtggtggcactaatatccactatctg
cacaagaagttaggactgtaa

DBGET integrated database retrieval system