KEGG   Tolumonas auensis: Tola_2531
Entry
Tola_2531         CDS       T00904                                 

Definition
(GenBank) hypothetical protein
  KO
K02804  N-acetylglucosamine PTS system EIICBA or EIICB component [EC:2.7.1.193]
Organism
tau  Tolumonas auensis
Pathway
tau00520  Amino sugar and nucleotide sugar metabolism
tau02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tola_2531
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Tola_2531
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tau02000]
    Tola_2531
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.193  protein-Npi-phosphohistidine---N-acetyl-D-glucosamine phosphotransferase
     Tola_2531
Transporters [BR:tau02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   N-Acetylglucosamine-specific II component
    Tola_2531
SSDB
Motif
Pfam: MCD_N TMEM43
Other DBs
NCBI-ProteinID: ACQ94125
UniProt: C4LAF0
Position
2760187..2761500
AA seq 437 aa
MVSIQSDDNQQRLLILPILLLTFAHMPQAIIAGIDYTGYLWLTIFQGLQQAAPLLLAMAL
AISRSRYQYDMQPLNACLSYVLLAKLLHSLGPANIPTDIIAALLSGYAVVWATPHTQKIR
LPSWLRAFQGDAVVLLCNGFFCMLLALPVAGLLHLFSQFLLQNHTVELLLWLEPLLLLSG
GTVPQLLATQVEWHSFLASPYVWLVVLCISWIFQRALIDIPGTKIQKKVLNGILSLLMIA
SGQTQPMLLLLLLWAPRHCIYMLFILGFINNGSHWLQQDQISYASIPDVWFAIPMSLLGI
LLYELRGYISQHPIQFANAAIAVPEARPETDEPDLLLDVDFLTISYLKAMGGLGNLVALR
ADLTRLIIDVETVADLDRDRLHRLGVMSIKTVSTQRAELLTGPIALTLESRIHNLAKRQS
LDLTPREIHPLMPFRLD
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggtatctatccagtcagatgacaatcaacagcgcctgttaatcttacctattctgctg
ctgacttttgcgcatatgccgcaagccatcattgcaggtattgattataccggatacctc
tggctgaccatttttcaaggcttacaacaagcagcgccgctattactggcgatggctctg
gctatcagccgcagtcgttatcaatatgacatgcagccattgaatgcctgcctgagttat
gtgttactggctaaactgctgcattcgctgggcccggcaaacatccctaccgacattatt
gccgcactgcttagtggctatgccgttgtctgggcaacaccgcatacacaaaaaatccgc
ttaccttcctggttacgggctttccagggggatgccgttgtcctgctgtgcaatggtttc
ttctgtatgctgctggcgctgccggtagcaggactgctgcatctgttcagtcagttctta
ctgcagaatcataccgtagagctattactctggctggaaccgttattgctgttatctggc
ggtacagtaccgcagttgctggcaacacaggtggaatggcattcgtttctggcatcacct
tatgtatggctggtagtactctgtatctcctggatttttcagcgtgcactgattgatatt
cccggcacgaaaatccagaaaaaagtgttgaatggcatattaagtctgctgatgatcgcc
tctggtcagactcagccgatgttgctgttattactactgtgggctccccgccactgtatt
tatatgctgtttattcttggctttatcaataacggcagtcactggctacagcaggaccaa
atttcctatgccagcatcccggatgtctggtttgccattccaatgtcgttgcttggtatt
ctgctgtatgaactgcgcggatacatcagccagcaccctatccagtttgccaacgcagcc
atagctgtacccgaagcgcgtccggaaacggatgagccggatctgttactggatgtggac
tttctgaccatcagctatctcaaagccatgggtgggttgggtaatctggttgcactacgg
gccgatctgacccgattgattatcgatgtggaaacggtagctgatttggatcgggatcgc
ctgcatcgccttggtgtcatgtcaatcaagacagtttctacacaacgggcagagttatta
accggccctatcgcactgacgctggaaagccggatccataatctggctaaacgccaatcc
ctggatttgacgccgagagagattcatccgctgatgccattccggctggactag

DBGET integrated database retrieval system