KEGG   Tolumonas auensis: Tola_2532
Entry
Tola_2532         CDS       T00904                                 

Definition
(GenBank) ribosomal protein L11 methyltransferase
  KO
K02687  ribosomal protein L11 methyltransferase [EC:2.1.1.-]
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tau03009]
    Tola_2532
Enzymes [BR:tau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     Tola_2532
Ribosome biogenesis [BR:tau03009]
 Prokaryotic type
  ribosomal protein modification factors
   Tola_2532
SSDB
Motif
Pfam: PrmA MTS Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_12 Met_10 Methyltransf_32 Cons_hypoth95 PCMT N6_N4_Mtase Methyltransf_18 UPF0020 Methyltransf_9 CMAS Methyltransf_15 Ubie_methyltran Methyltrans_SAM Methyltransf_5
Other DBs
NCBI-ProteinID: ACQ94126
UniProt: C4LAF1
Position
2761585..2762463
AA seq 292 aa
MPWIQIKINATAKTANKVSNMLMGLGAQAVTYMDAQDTPVYEPLPGETKLWGDTRCIGLF
DAEVDPAPIVAFFQQHFGEDVPYQVELLEDKDWVREWMEHFQPMQFGERLWICPSWRDVP
DPTAVNVLLDPGLAFGTGTHPTTALCLQWLDSLDLKGKTLVDFGCGSGILAIAALKLGAE
RVIGIDIDPQAIEASRDNAQRNGVSDQLELYLPEDQPKNFQADIVVANILAGPLRELSGL
ISGLVKPHGLMAISGILESQAPELLEVYSQWFAMNPATEREEWCRLDGIKKG
NT seq 879 nt   +upstreamnt  +downstreamnt
atgccctggatccaaatcaaaatcaatgccaccgccaagaccgccaataaagtcagcaac
atgctgatgggacttggtgcgcaggccgtcacctacatggacgcacaggatacacctgtc
tatgaacccttgccgggcgaaaccaaattgtggggtgatacccgctgcattggtctgttc
gatgcagaagtggatccggcaccgatcgtggcgttcttccagcaacattttggcgaagat
gtcccctatcaggttgaactgctggaagacaaagactgggtgcgtgagtggatggaacat
ttccagccgatgcaatttggcgagcgcctgtggatctgcccgagctggcgtgatgtgcct
gacccaacggcagtaaatgtactgctggatccgggtctggcgtttggtaccggtacacac
ccaaccacggcactttgtctgcaatggctggacagtctggatctgaaaggcaagacgctg
gtcgattttggctgcggctccggcattctggcgattgctgcgctgaaactgggtgcggaa
cgtgtgatcggtattgatattgatcctcaggcgattgaagccagccgtgacaatgcgcaa
cgtaatggcgtcagcgaccagcttgaactgtatctgccggaagatcagccgaagaatttc
caggctgatatcgtggtggcgaatattctcgccggcccgctgcgtgagctgtccggactg
atcagtggtctggtgaaaccgcatggtctgatggcgatttccggtattctggaaagtcag
gcaccggagctactggaggtttacagccagtggtttgcgatgaatccggcaacggaacgt
gaagagtggtgccgtcttgatggaatcaagaaagggtaa

DBGET integrated database retrieval system