KEGG   Tolumonas auensis: Tola_2533
Entry
Tola_2533         CDS       T00904                                 

Definition
(GenBank) TIM-barrel protein, nifR3 family
  KO
K05540  tRNA-dihydrouridine synthase B [EC:1.-.-.-]
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tau03016]
    Tola_2533
Enzymes [BR:tau01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     Tola_2533
Transfer RNA biogenesis [BR:tau03016]
 Prokaryotic type
  tRNA modification factors
   Dihydorouridine synthases
    Tola_2533
SSDB
Motif
Pfam: Dus His_biosynth SOR_SNZ DHO_dh NanE Oxidored_FMN ThiG IMPDH TMP-TENI Pterin_bind G3P_antiterm
Other DBs
NCBI-ProteinID: ACQ94127
UniProt: C4LAF2
Position
2762633..2763601
AA seq 322 aa
MQIGPYSLPAPVIVAPMAGVSDQPFRQLCLRMGAGMAVSEMMSANPDTWDTDKSLKRMYL
ADEPGIRAVQIVGSEPEWMADAARRSVSEGAQIVDINMGCPAKKINRRLAGSALLQDPAL
VREILQTVVAAVDVPVTLKIRTGWDTEHRNGLEIAEIAESCGVQALTVHGRTRACLFNGQ
AEYDTIRAIKQHISIPVVANGDIDTPQKAQAVLEYTGADAIMIGRAAQGQPWLFSRIRHF
LTHGSDLPSPEWDAVRIIVLEHVAALHQFYGEYKGVRFARKHVAWYLERYGSAKHFRRGF
NALTSAEEQLDALELFFSNAIA
NT seq 969 nt   +upstreamnt  +downstreamnt
atgcaaattggaccttattcgttaccagccccggtgatcgttgcaccgatggccggtgtt
tcagaccagcccttcaggcagttgtgtctgcgaatgggagccggtatggcggtctctgag
atgatgtcggcaaacccggatacctgggataccgataaatcgcttaagcgaatgtatttg
gctgatgagccgggcatacgcgctgtgcagatcgtgggttcagaaccggaatggatggct
gatgccgcccgccgctctgtctccgaaggggcacagattgtcgatatcaatatggggtgt
cccgccaaaaagattaatcgtcgtttggccggttcagccctgctgcaagaccccgcgctg
gtgcgcgagatcctgcaaaccgtagtagctgctgtggatgttcctgtcaccctgaagatt
agaaccggatgggatacggaacatcgcaatgggctggaaattgctgaaatagctgaatcc
tgtggtgttcaggcactgactgttcacgggcgtacccgtgcgtgtttattcaatggtcag
gcggaatacgatacgatccgggctataaaacagcatatctctattcctgtggttgctaac
ggagatatcgatactcctcagaaagcgcaggctgtactggagtacaccggtgccgatgcc
atcatgattgggcgagctgcacaaggacaaccctggttgtttagccgcattcgccatttc
ctgacgcacggttcagatctgccatcgccggaatgggatgcggtcagaatcatagtgctg
gaacatgttgcagctttgcatcagttctacggcgaatacaaaggagtgcgttttgccaga
aaacatgttgcctggtatctggagagatatgggtcagcaaagcatttccgcagaggtttc
aatgcgctgacaagtgctgaagagcaacttgacgcattggaactgttttttagtaacgca
attgcataa

DBGET integrated database retrieval system