KEGG   Tolumonas auensis: Tola_2534
Entry
Tola_2534         CDS       T00904                                 

Definition
(GenBank) transcriptional regulator, Fis family
  KO
K03557  Fis family transcriptional regulator, factor for inversion stimulation protein
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tau03000]
    Tola_2534
   03036 Chromosome and associated proteins [BR:tau03036]
    Tola_2534
   03400 DNA repair and recombination proteins [BR:tau03400]
    Tola_2534
Transcription factors [BR:tau03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    Tola_2534
Chromosome and associated proteins [BR:tau03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Tola_2534
DNA repair and recombination proteins [BR:tau03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Facilitator
      Tola_2534
SSDB
Motif
Pfam: HTH_8 Phage_NinH HTH_28 DUF2232
Other DBs
NCBI-ProteinID: ACQ94128
UniProt: C4LAF3
Position
2763620..2763919
AA seq 99 aa
MLDQTLTSEALVTTVTHAQTHQPVQRPLRDSVQQALRNYLAQLNGQDVAELYDMVLSEVE
APMLDIIMQYTRGNQTRAAIMMGINRGTLRKKLKKYGMN
NT seq 300 nt   +upstreamnt  +downstreamnt
atgttggatcaaaccctgacttctgaggcactggtaaccaccgtcactcacgcacaaact
catcaacctgttcagcgtccattgcgtgactccgtacaacaggctttacgtaactatctg
gctcaattaaacggccaggacgtcgctgaactgtacgatatggttctgagtgaagttgaa
gcaccaatgctcgacattatcatgcagtacacccgtggtaatcagacccgagctgcaatc
atgatgggtatcaaccgcggtacactgcgcaagaaactgaaaaaatacggcatgaactag

DBGET integrated database retrieval system