KEGG   Tolumonas auensis: Tola_2535
Entry
Tola_2535         CDS       T00904                                 

Definition
(GenBank) sulfatase
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: Sulfatase EptA_B_N
Other DBs
NCBI-ProteinID: ACQ94129
UniProt: C4LAF4
Position
2764299..2765921
AA seq 540 aa
MNFINLTLRQVVSYSRVQEFLSWHSGILFLLALLINISLGYELHVLDAVGFFCFLCLLKR
LSWRAFKYILIVSSLVAACYFPFGRTYGAPNFNSILSLYSSNPGEAGEILRVFPLWYYLV
SLGILGFALLLLKRPVRLFPRWSGHHSSLLTVFLVISLVVPLKVFYTEGTFSLLNASYPV
FRFVKDITLINMTVNAEHQRMQDLATLQDNWHVIAVKPAHQVYVVVIGESVRRDAMGAFG
GQWDNTPFVSHVNGVLFQNYLSAASSTQQSLGLTLTLVGKDEQPQYQNNIVTLAKRAGFH
TYWFSNQGQLGNYDTAIASIAKRADNVHFLKNGNFFSQDTQDTDLLKFTNDALSENSEAP
KLIVYHLIGSHPKACERTHHQYATFVNNEEVSCYLHSITQTDSFLASLHQQLQNSGKDFS
MIYFSDHGLAFNERGSQSEYLSHNDQYQQNYQVPMFITSSGDTHQRVIKTVRSANDFMSL
FAEWSGIRSREVVPKYHFISEQPAPPAYVTNFTPNRVDYNKLPQDPFVSRSNAPSRTALR
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgaattttataaacttaaccttacgacaggttgtctcttattcccgtgtacaggaattt
ttgagctggcactcaggaattttgttcctgctggccttgctgattaatatttcgcttggc
tacgaattgcatgtgctggatgcggtgggtttcttttgcttcttatgtttgctgaaaagg
ctgtcttggcgcgcattcaaatacatactgattgtcagctctctggtagctgcctgttat
ttcccgtttggccgtacttacggagccccgaacttcaatagcattctttcactttactct
tccaacccgggagaggctggtgagatactgcgggttttccctctctggtactatctggtt
tccttggggattctggggtttgccttgctgctgctgaagcgcccggtccgacttttcccg
cgttggtcaggtcatcattcttcgttgttgacagtgtttttggttatctcgctggtggta
ccgctgaaagttttttataccgaaggcacgttttctttgctgaatgccagctatccggtg
ttccgttttgtaaaagacatcaccttgattaatatgaccgtgaatgccgaacaccagcgt
atgcaggatctggccaccttgcaggataactggcatgtcattgccgtaaaacctgcgcat
caggtgtatgtggtggtgataggcgaaagtgttcggcgtgatgccatgggcgcatttggc
ggccagtgggataacacccctttcgttagccatgtgaacggcgtactgttccagaattat
ctgtctgcagcttcatcaacccagcaatctttggggctgacgctgacgctggttggaaag
gatgaacagcctcaataccagaataatattgtcacactggcaaaacgcgccggattccat
acctactggttctctaaccaaggacagctgggaaattacgatactgctatcgccagcatc
gccaagcgggcagataacgtccattttctgaaaaacggtaatttcttttcgcaggatacc
caggacacggaccttttgaaatttaccaatgatgcgctgagcgaaaactccgaagcaccc
aagctgattgtttatcatctgatcggatctcatccgaaagcctgtgaacgtacccatcat
cagtatgcgacgtttgtgaataacgaagaagtctcctgctacctgcacagcatcacacag
accgacagttttctggcctcgctgcaccagcagttgcaaaacagtggcaaggatttttcg
atgatctatttttccgatcatggcttagccttcaacgagcgtggttcgcagtctgaatac
ttgtcacacaacgaccagtatcagcaaaactatcaagtgccgatgtttattacttccagc
ggggatactcaccagcgtgtgatcaagacggtgcgttcagctaacgatttcatgtcattg
tttgctgaatggagcgggatccgcagccgggaagttgtgcctaaatatcacttcatttcg
gagcaaccggctccgcctgcctatgtcaccaacttcactccgaatcgggtggattacaat
aaactaccgcaggatccctttgtttctcgttctaatgctccgtcacgtacggcactgcgt
taa

DBGET integrated database retrieval system