KEGG   Tolumonas auensis: Tola_2536
Entry
Tola_2536         CDS       T00904                                 

Definition
(GenBank) ABC transporter related
  KO
K05776  molybdate transport system ATP-binding protein
Organism
tau  Tolumonas auensis
Pathway
tau02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Tola_2536
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tau02000]
    Tola_2536
Transporters [BR:tau02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Molybdate transporter
    Tola_2536
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 IstB_IS21 AAA_22 SbcCD_C AAA AAA_29 AAA_23 NB-ARC NACHT HopA1 AAA_30 RsgA_GTPase YqjK AAA_10 ATPase_2 DUF2791 DUF87 Rad17 TIP49
Other DBs
NCBI-ProteinID: ACQ94130
UniProt: C4LAF5
Position
2766061..2767512
AA seq 483 aa
MLTIRNAVFPISTHKKLTITDFQLSPGECCTVIGNNGSGKTVMARALNQEIMAESGACVF
DCRSELVSFEKQLKLYDDEWQRINTDMLSAEEEIATTTAAIIQLNRNDEAYCRELAQQFG
ITHLLEQSFTALSSGEGRKVLLAQALMSKPQLLILDEPFDGLDVQARARLMTILEQLLQS
GMALALIVNRLDEIPSFAQKMGWILDCQFTELHNRNAFFADPLTQQLLHCASEQKVILPP
PLQSSASPELSDPIIDLQQINVSYGERTILHELSWQINRGEHWHIAGPNGCGKTTLLHLI
TGDHPQCYSNHVTLFGKRRGSGESIWDIKQKMGIVSPALHMSYRVAGTPLTVILSGFYDS
IGLYQQPGDQELALARQWLKLLGMEKLEQTSFLQLSYGQQRLLLIARAMVKHPPLLILDE
PLQGLDSLNRHLVLQYIDRLVAHSKSQLLYVSHHAEDVPQCMTHRLQFIAKANDGYDYEQ
TRL
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgttaactatccgcaacgcagtctttcccattagtacgcataaaaaactgactattact
gattttcagctatcccccggcgagtgttgtaccgtcatcggtaacaacggtagcggcaag
accgtgatggcgcgtgcactgaatcaggaaataatggctgaatccggagcatgtgttttt
gactgtcgctcagagctggtctcttttgaaaagcagctcaagctgtatgacgatgagtgg
cagcggatcaataccgatatgctgagtgcggaagaagagatagccacgaccactgccgcg
attattcagctcaaccggaatgatgaagcttattgccgcgagctggcgcaacaatttggt
attacccatctgctggaacaatcatttaccgcgttatccagcggagaaggtcgcaaagtg
ctgctggcgcaggcactgatgtcaaaaccgcagttgctgattctggatgaaccgtttgat
gggctggatgtgcaggcccgcgcccggctgatgaccatattagagcagttactgcaaagt
ggcatggcactggcgctgattgttaatcgcctggatgaaatcccgtcatttgcgcaaaaa
atgggttggatactggattgccagtttacggaattacataaccggaatgcgttctttgcc
gatccgctaacgcagcaattgctgcactgtgcttcagagcagaaagtcatcttaccgcca
ccattgcaatcatctgccagtcctgaactcagcgatccgattattgacctgcagcagata
aacgtcagttatggtgagcgcaccatattgcatgagctgagctggcagattaatcgtggc
gaacactggcatatcgccggtccgaacggctgcgggaaaaccacattgctgcaccttatc
accggtgatcatccgcaatgttatagtaaccatgtgacgttatttggtaagcggcgggga
tcgggtgaaagtatctgggacataaaacagaaaatgggcatagtcagccctgccctgcat
atgtcttaccgtgtcgccggaacaccgctgacggtcattctttccggtttttatgactct
atcgggctatatcagcaacccggcgatcaggagctggcgctggcccggcaatggctgaaa
ttactcgggatggagaaactggagcaaacctcatttctccagctctcttacggtcagcaa
cgcctgcttttaattgcccgggcgatggtcaagcatccgccgctgttgatccttgatgag
cccttacaagggctggatagtctgaaccggcatctggtcctgcagtatattgatcggctg
gtagcacatagcaaaagccagttgctgtatgtttcgcatcatgcggaagatgtcccgcag
tgcatgacgcaccgcctgcaatttattgccaaagcgaatgatggctatgactatgaacaa
acccgtctataa

DBGET integrated database retrieval system