KEGG   Tolumonas auensis: Tola_2537
Entry
Tola_2537         CDS       T00904                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_9 Acetyltransf_8 FR47 Acetyltransf_CG Acetyltransf_15 Acetyltransf_3 Acetyltransf_13
Other DBs
NCBI-ProteinID: ACQ94131
UniProt: C4LAF6
Position
complement(2767514..2767996)
AA seq 160 aa
MLTIVTADYYNQQQMSDLLLLLDLYAQDPMGGAEPLSAECRQQLPQMLQQCSAAISLLAY
QDGQPAGLLNAFQTVSTFAARPLINVHDLAVVPAFRGQGIATSLLQHVEQIARERDCCKL
TLEVLSGNQTAQQTYLRCGFAGYELDPAQGHALFWQKKLV
NT seq 483 nt   +upstreamnt  +downstreamnt
atgttaaccatagtaactgccgattattataatcaacaacagatgtcggatctgctgtta
ttgctggatctttatgcgcaggacccaatgggtggcgccgaaccactgtctgctgaatgt
cgtcagcaactaccgcaaatgttacaacagtgctctgcagccatctcgttgctcgcttat
caggatggccagccggcagggctactgaatgccttccagacagtatctaccttcgctgcc
cgtccgctgattaatgtgcatgatctggctgtagtcccggcattccgggggcaggggatc
gcgacctcgttattacagcatgtggagcaaatcgcccgtgaacgcgattgctgtaagctg
acgctggaagtgctctcaggcaatcagactgcgcaacaaacttatctgcgttgcggcttt
gccggatacgaactcgatccggcacaaggtcacgcattattctggcagaaaaagctcgtc
tga

DBGET integrated database retrieval system