KEGG   Tolumonas auensis: Tola_2538
Entry
Tola_2538         CDS       T00904                                 

Definition
(GenBank) hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Other DBs
NCBI-ProteinID: ACQ94132
UniProt: C4LAF7
Position
2768117..2768617
AA seq 166 aa
MKYRRIISLFMVAALLPLTQAQARPHFDGRGDDDDRREHHHRHRDHGRVYYPGPVRVYPG
PVYAHAPARYNIMPPGYKTVIAAGVTYFVLNELWYRMHGGAYEQVQAPASSNVTIINNGA
TTTTIANTGSVMNVIDVNGSRYYTQNGRFYRRTPDGQYLEVAPPSY
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaataccgtcggatcatatcgttgtttatggttgctgcgctgttacccctgacgcag
gcccaggccagacctcattttgacggtcggggagatgatgatgaccgcagagaacaccac
catcgtcaccgggatcatggccgggtttattacccggggcctgttcgtgtctatccggga
cccgtttatgcccatgctccggctcgttacaacatcatgccaccgggatacaaaaccgtc
attgctgccggggtgacttattttgtactgaatgagctctggtaccgcatgcatggcggc
gcctatgaacaggtccaggcaccggccagcagcaatgtcaccattattaataatggggca
acgaccacaaccatcgcgaataccggctcagtcatgaatgtcattgatgtgaatggcagc
cgttattatacgcagaacggacgattttaccgtcgcacaccagatggccagtatctggaa
gttgcaccacccagttattaa

DBGET integrated database retrieval system