KEGG   Tolumonas auensis: Tola_2539
Entry
Tola_2539         CDS       T00904                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
tau  Tolumonas auensis
Pathway
tau00130  Ubiquinone and other terpenoid-quinone biosynthesis
tau00627  Aminobenzoate degradation
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
tau01220  Degradation of aromatic compounds
Module
tau_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Tola_2539
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Tola_2539
Enzymes [BR:tau01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     Tola_2539
SSDB
Motif
Pfam: Flavoprotein
Other DBs
NCBI-ProteinID: ACQ94133
UniProt: C4LAF8
Position
complement(2768703..2769305)
AA seq 200 aa
MTQAITLAITGASGAIYGVRLLEQLLQAGCQVHLLMSSAARVVLTTELDLIWPPEPLACQ
QYLIRHYGCDENQLRVYGRDDWFSPVASGSAAPKQMVICPCSMGTLAAITHGLSDNLIER
AADVVLKERGHLLLVPRETPYSAIHLENMLKLTQLGATILPASPGFYHKPASIDELVNFM
VARILDHLQIQQSISPRWAQ
NT seq 603 nt   +upstreamnt  +downstreamnt
atgacacaggcgatcacgttagccattaccggcgcatccggggccatctatggtgttcgt
ctgctggagcaattacttcaggctggctgtcaggtgcatctgctgatgtcatcggcagcc
agagtcgtgctgactaccgaactggatctgatatggccgcctgaaccgctggcctgtcag
caatatttaatacggcactatggctgtgatgaaaatcagctgcgtgtttacggacgtgat
gactggttttcaccggtcgcatccggttctgcggccccgaagcagatggtgatctgcccc
tgctcaatgggtaccttagcggccattacacatggcctgtcggataatctgattgaacgt
gcggctgatgtcgtgctgaaagagcgcggtcatttgctgctggtgccccgcgaaacaccg
tactctgcgattcatctggagaatatgctgaagctcactcagctgggggcaacaatattg
cctgcttctcccggcttctatcataagccggccagtatcgatgaactggttaactttatg
gtggcccgcattctggatcatctgcaaatacagcaatccatctctccgcgctgggcgcaa
taa

DBGET integrated database retrieval system