KEGG   Tolumonas auensis: Tola_2540
Entry
Tola_2540         CDS       T00904                                 

Definition
(GenBank) UDP-N-acetylmuramate
  KO
K02558  UDP-N-acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [EC:6.3.2.45]
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tola_2540
Enzymes [BR:tau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.45  UDP-N-acetylmuramate---L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptanedioate ligase
     Tola_2540
SSDB
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Other DBs
NCBI-ProteinID: ACQ94134
UniProt: C4LAF9
Position
complement(2769308..2770678)
AA seq 456 aa
MHIHILGICGTFMGGIAVLAKQQGHKVTGSDLNVYPPMSTQLEEQGIELVQGYDPSQLNP
APDMVVIGNAMSRGNPCVEYVLDRNLPYTSGPEWLRDNVLQQRWVIGVAGTHGKTTTASM
VAWILEHAGLEPGFLIGGVPGNFPFSARLGKAPFFVIEADEYDCAFFDKRSKFVHYRPRT
LIMNNLEYDHADIFPDLASIQRQFHHLVRTVPSNGRILMPAHDPALAEVRTMGCWSEVEL
VEGDGANWQAKLLKEDGSAFVVLLNGEVQGEVHWSGLGRHSVHNGLMAIAAARHAGVRTA
DGIAALSEFVMPKRRMELRGEVAGIKVYDDFAHHPTAIATTIAGLRANVGTARILAVLEP
RSNTMKMGVHQGELIKSLVQADKAYMFAPTGLGWDIHQLAQKAPIPTTVQHDINHLVDML
VAEAKSGDQILVMSNGGFDGIHSKLLEKLTKRYSQE
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgcatattcacattctgggcatctgcggcacctttatgggcggcattgcagtgctggcg
aaacagcagggtcacaaagtgactggttctgatcttaacgtctatcctccgatgagcacc
cagttagaagagcagggtattgaactggtgcagggctacgatccgtcgcaactcaatccg
gcacccgatatggtggtgatcgggaatgcgatgagccgcggtaatccctgtgtggaatat
gttctggatcgcaatctgccttacacctctggccccgagtggttgcgcgataacgtgtta
caacagcgctgggttatcggtgttgccggcacccatggcaaaaccaccaccgccagcatg
gtagcgtggatcctggaacatgccggtctggaacccggattcctgatcggtggcgtaccg
ggtaatttcccgttttctgcccgtttaggtaaagcgccgtttttcgtgatcgaagcggat
gaatatgattgtgcgtttttcgataaacgttccaagtttgttcattaccgtccgcgtacg
ttgatcatgaacaatctggaatacgatcatgccgatattttccctgatctggcatccatc
caacggcaattccatcatctggtccgtactgtgccgtccaatggccgcatcctgatgccc
gcacatgatccggcgttggcggaagtgcgtactatgggctgctggagcgaagttgagctg
gtggaaggtgacggtgctaactggcaggctaaactgttaaaagaagatggttctgctttt
gtcgtgctgctgaatggtgaagtgcagggtgaagttcactggagcggtctgggccgacac
agtgtgcacaatggcctgatggcgattgctgccgcccgtcacgccggggtgcgtactgca
gacggtattgccgcactgagcgaattcgtgatgccgaaacgccgcatggagttacgcggt
gaggtagcgggtatcaaagtttacgatgactttgcccatcacccgaccgccattgcgacc
accatcgcgggattgcgggccaacgtgggtaccgcccgtattctggccgtgctggagccc
cgctctaataccatgaaaatgggtgtacaccagggtgagctgatcaagagtctggtacag
gcggataaagcgtatatgtttgcaccaaccgggctgggctgggatattcaccagttggca
cagaaagcgccgatcccaactacggttcagcatgatattaatcatctggtcgatatgctg
gtggcggaagccaaatccggtgatcagatattagtcatgagtaacggcggcttcgatggc
atacacagcaaactgctggaaaaattaaccaaacggtattctcaggagtaa

DBGET integrated database retrieval system