KEGG   Tolumonas auensis: Tola_2541
Entry
Tola_2541         CDS       T00904                                 

Definition
(GenBank) Inorganic diphosphatase
  KO
K01507  inorganic pyrophosphatase [EC:3.6.1.1]
Organism
tau  Tolumonas auensis
Pathway
tau00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Tola_2541
Enzymes [BR:tau01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     Tola_2541
SSDB
Motif
Pfam: Pyrophosphatase InPase
Other DBs
NCBI-ProteinID: ACQ94135
UniProt: C4LAG0
Position
2770838..2771371
AA seq 177 aa
MSLNLVPAGKDLPEDIYVVIEIPQNADPIKYEIDKASGAIFVDRFMSTPMFYPCNYGYIN
NTLSLDGDPVDVLVPTPYPLVPGSVIRCRPVGVLKMSDEAGQDAKLVAVPHTKLTKLYDH
INDVHELPELLKGQIRHFFERYKELEHGKWVKVEGWGDKAEAIAEIQASVVRYEESK
NT seq 534 nt   +upstreamnt  +downstreamnt
atgagcttgaatctggttccagctggcaaagatctgccggaagatatctatgtagttatt
gagatcccacaaaacgcagatccaatcaaatatgaaatcgacaaagcgtctggtgccatc
tttgtagaccgtttcatgtcgaccccaatgttctacccatgcaactacggttacatcaac
aacactctgtctctggatggtgatcctgttgacgtgctggtgccgactccatacccattg
gtgccaggttcagtgatccgctgccgtccggttggcgtactgaaaatgagcgatgaagct
ggtcaggatgccaaactggttgctgttccgcacaccaaactgactaaactgtatgatcat
attaatgacgtgcatgaactgccagaattgctgaaaggtcagatccgccatttcttcgag
cgttataaagaactggaacacggtaaatgggttaaagtagaaggctggggcgacaaagct
gaagccatcgctgaaatccaggcttctgttgttcgttacgaagaaagtaaataa

DBGET integrated database retrieval system