KEGG   Tolumonas auensis: Tola_2542
Entry
Tola_2542         CDS       T00904                                 

Definition
(GenBank) hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Other DBs
NCBI-ProteinID: ACQ94136
UniProt: C4LAG1
Position
complement(2771449..2771547)
AA seq 32 aa
MKNDNKMPKTKLLVLLLVYIALVIGLAVYLYS
NT seq 99 nt   +upstreamnt  +downstreamnt
atgaaaaatgacaacaagatgccgaaaacaaagttactcgttttgctgctggtgtatatc
gcgctggtaatcgggttagcggtttatctgtattcgtaa

DBGET integrated database retrieval system