KEGG   Tolumonas auensis: Tola_2543
Entry
Tola_2543         CDS       T00904                                 

Definition
(GenBank) adenylylsulfate kinase
  KO
K00860  adenylylsulfate kinase [EC:2.7.1.25]
Organism
tau  Tolumonas auensis
Pathway
tau00230  Purine metabolism
tau00920  Sulfur metabolism
tau01100  Metabolic pathways
tau01120  Microbial metabolism in diverse environments
Module
tau_M00176  Assimilatory sulfate reduction, sulfate => H2S
tau_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Tola_2543
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Tola_2543
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     Tola_2543
SSDB
Motif
Pfam: APS_kinase AAA_33 AAA_18 Torsin AAA_16 AAA_29 P-loop_TraG KTI12 MeaB CbiA Zeta_toxin SRP54 AAA_17 ParA DUF87 IstB_IS21 ABC_tran PRK RNA_helicase
Other DBs
NCBI-ProteinID: ACQ94137
UniProt: C4LAG2
Position
complement(2771700..2772296)
AA seq 198 aa
MNKDIVWHQHDINKAARAEQKGHKAFLLWFTGLSGSGKSTIAGALEQELFRRGVHTYLLD
GDNVRHGLCKGLGFTTADRQENLRRVGEAAKLMVDAGLVVLAAFVSPYRADRDAIRALLP
EGEFVEVFVDTPLAECEQRDPKGLYKKARAGEIKHFTGIDDPYEAPVQPEVHIHNHDRSV
EEVVAEVLAKLQARELLS
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaataaagatatcgtctggcatcagcatgacatcaataaagccgcccgtgcagagcaa
aaagggcataaagcttttctgttgtggttcaccggtttatccggttccggcaaatcaacc
attgccggggcactggagcaggaactgtttcgtcgtggcgtacatacctatctgttagat
ggcgacaatgtccgtcatggcttatgtaaaggtttaggttttaccacagcggatcgtcag
gaaaacctgcgtcgcgtgggcgaggcggccaaactgatggtcgatgccggtctggtggta
ttagccgcttttgtttcgccttaccgggctgatcgtgatgcgatccgtgccttgctgccg
gaaggtgagtttgtggaagtgtttgttgatacgccattagctgagtgtgaacagcgcgat
ccgaaaggtttatataaaaaagcgcgggcaggggagatcaaacattttaccggtattgat
gatccctatgaggcccctgtacagccggaagtacatatccacaatcatgaccgttctgtt
gaagaagttgttgccgaggtgttagcaaaattacaggcccgtgaactgttgtcttaa

DBGET integrated database retrieval system