KEGG   Tolumonas auensis: Tola_2544
Entry
Tola_2544         CDS       T00904                                 

Definition
(GenBank) sulfate adenylyltransferase, large subunit
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
tau  Tolumonas auensis
Pathway
tau00230  Purine metabolism
tau00261  Monobactam biosynthesis
tau00450  Selenocompound metabolism
tau00920  Sulfur metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
Module
tau_M00176  Assimilatory sulfate reduction, sulfate => H2S
tau_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Tola_2544
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Tola_2544
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Tola_2544
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Tola_2544
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     Tola_2544
SSDB
Motif
Pfam: GTP_EFTU MMR_HSR1 GTP_EFTU_D2 SRPRB GTP_EFTU_D4
Other DBs
NCBI-ProteinID: ACQ94138
UniProt: C4LAG3
Position
complement(2772511..2773929)
AA seq 472 aa
MNSTIAEAIKEEGIENYLKNQQHKSLLRFLTCGSVDDGKSTLIGRLLHDSRQVYEDQLKT
LHSDSQKIGTTGEKLDFALLVDGLQAEREQGITIDVAYRYFSTPKRKFIIADTPGHEQYT
RNMATGASTCDLAIILIDARRGVLEQTRRHSFIASLLGIRQFIVAVNKMDLVNFDEKVFD
SIKKEYLEFASGLPKTDIRVVPISALDGENLVVNSELTPWYQGEPLLTMLENAEVGTRDL
DLPFRMPVQLVSRPNLDFRGYMGTVAAGVVKPGDVVKVLPSGKESKVKRIVTFDGDLDYA
LPGEAVTITLEDEIDISRGDLLVAPDAETQVTQHVLANVVWMTEEPLQANRQYDIKLATR
KTRGHVDAIRHRIDVNTLEKHDATELKLNEIGLLELSLTNAVGVDPYNTVRDTGSFIIID
RLSNVTIGAGMVVEALAGKTAGKAEFSEFELEFNALVRKHFPHWQALDISKL
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgaacagcaccattgccgaagcgatcaaagaagaaggtattgagaactacctgaaaaat
cagcagcacaagagcctgttgcgtttcctcacctgcggtagcgtggatgacggtaaaagc
accctgatcggccgtctgttgcacgattcccgtcaggtgtatgaagatcagctgaaaacg
ctgcattctgacagtcagaagatcggtaccaccggtgagaaactcgatttcgccctgctg
gtggatggtctgcaggcggagcgtgagcagggcatcaccattgatgtggcttaccgttat
ttctcgacgcccaaacgtaaatttatcattgctgatacgccaggccatgagcaatacacc
cgtaacatggcgaccggtgcttccacctgtgatctggcgatcatcctgatcgatgcgcgt
cgcggtgtattggagcagacccgtcgtcacagctttatcgccagcctgctggggatccgt
cagttcatcgtggcggtcaacaaaatggatctggtgaacttcgatgagaaggtcttcgac
agtatcaaaaaagagtatctggaatttgcttccggcttaccgaaaaccgatatccgcgtg
gtaccaatctcggcactggacggcgaaaatctggtggtaaacagtgaactgacgccatgg
tatcagggcgagccactgctgaccatgctggaaaatgccgaagtcggcacgcgtgatctg
gatctgccgttccgtatgccggtacagctggtgtctcgtcctaacctcgatttccgtggt
tacatgggcacagtggctgcgggcgtggttaaaccaggtgatgtggtaaaagtattaccg
tcaggtaaagagagcaaagttaaacgtattgtcactttcgatggtgatctggattacgcc
ctgccgggtgaggccgtaaccatcacactggaagatgaaatcgacatcagccgtggtgat
ctgctggtcgcaccggatgcggaaacgcaggtgacacagcacgtgctggccaatgtggtg
tggatgacggaagagccattgcaggcgaatcgtcagtacgatatcaagctggcaacccgt
aaaacccgcggtcatgttgatgcgatccgtcaccgtattgatgtgaatacgctggaaaaa
catgatgccaccgagctgaaactgaacgaaatcggtttgctggaattgtcgctgaccaat
gccgttggtgttgatccttacaacactgtgcgtgataccggtagctttatcattatcgat
cgcctgagcaatgtgacgattggtgccggcatggtagtggaagcgttagccggaaaaaca
gccggtaaagccgagttcagcgagtttgaactggagttcaatgcgctggtgcgtaaacac
ttcccgcactggcaggcgctggatatcagcaagctgtaa

DBGET integrated database retrieval system