KEGG   Tolumonas auensis: Tola_2546
Entry
Tola_2546         CDS       T00904                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
tau  Tolumonas auensis
Pathway
tau00860  Porphyrin and chlorophyll metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
Module
tau_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tola_2546
Enzymes [BR:tau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Tola_2546
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Tola_2546
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Tola_2546
SSDB
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M TrkA_N Radical_SAM Shikimate_DH
Other DBs
NCBI-ProteinID: ACQ94140
UniProt: C4LAG5
Position
complement(2774931..2776337)
AA seq 468 aa
MDYLPLFARLNNRAVLLVGGGDIALRKARLLLDAGANLTVVAPSLHEELTELLVGHTYIP
SRFTAAYLNDQMLVIAATDDEEVNAEVAAAADAANIWVNVVDDPDRSSFIFPSIIDRSPI
MVAVSSGGKAPVLVRMLRERLEALLPKHLGALANLSGEWRNQIKQKLGDITSRRRFWEKA
FASPQLATLLETEQHDSAEQWMADQLQADDYAGGEIVLVGAGPGDAGLLTLKGLQQIQQA
EVVLYDQLVSPEVLNLVRRDAERISVGKKAGHHSVPQHEINELLLSHARAGKRVVRLKGG
DPFMFGRGAEELQAARAEGIPFSVVPGITAAAGATAYAGIPLTHRDSAQSAVFITGHCKQ
DGEEPDWAALAASNQTLVIYMGLIGSPAITERLIAHGRRPETPVALIERGTTVRQRVLRG
TLQELPELAKDAHSPSLIVIGEVAALADTLSWFGGDTASGKEHLINLA
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggattatcttccgctgtttgccagattaaataatcgcgccgtcctactggttggtggt
ggtgatatcgccctgcgaaaagcgcgtttgttgctggatgccggcgccaatctgacagtg
gttgctccttcactgcacgaagagctgacggaattactggttgggcatacttatatccca
tcccgttttactgcggcgtatctgaatgaccagatgctggtcattgcggcgaccgatgat
gaagaagtgaatgcagaagtagctgcggcagcggatgcggccaatatctgggtaaacgtg
gtcgatgatccggaccgctccagctttattttcccgtcgattatcgaccgctctcccatc
atggtggcggtatcaagcggcggaaaagcgccggtactggtgcgcatgctgcgtgaacgt
ctggaagcgttattgccgaaacatctgggtgcgttagccaatttatccggtgaatggcgt
aaccagatcaaacaaaaactcggtgacattacctcccgtcgccgtttctgggagaaagcc
tttgcctcaccgcaactggccaccttgctggaaactgaacaacatgattctgctgaacag
tggatggctgatcagttacaggcagatgattacgccggtggcgaaattgtgctggtgggg
gcaggtccgggcgatgccggtctgctgacactgaaagggctgcaacagatccagcaagcc
gaagtggtgctgtatgaccagctggtatcgccggaagtgctgaatctggtgcgtcgcgat
gcggaacgtatcagcgtgggtaaaaaagcgggccaccacagtgtgccgcaacatgaaatc
aatgaattgttattaagccatgcccgcgctggtaaacgcgtggttcgtctgaaaggcggt
gacccgtttatgttcgggcgaggtgctgaagagctgcaggccgcgcgggcagaaggtatt
ccgttctcggtagtaccgggcattacagcggctgcaggggcaaccgcttacgcaggtatc
ccgctgacccaccgtgacagcgcgcagagtgcggtgtttatcaccgggcattgcaaacag
gatggtgaagagccggactgggcggcactggctgccagcaaccagacactggtgatttac
atgggcctgattggttccccagctattactgagcggctgattgcgcatggccgtcgtccg
gagaccccggtcgccctgattgaacgcggtactaccgtcagacaacgcgtgttgcgcggt
acgctgcaggagttacctgaactggccaaagatgcacacagcccgtcactgattgtgatt
ggcgaggttgccgcactggccgacacattaagctggtttggcggtgacactgcctccggc
aaagaacatttgatcaatcttgcctga

DBGET integrated database retrieval system