KEGG   Tolumonas auensis: Tola_2547
Entry
Tola_2547         CDS       T00904                                 

Definition
(GenBank) band 7 protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: Band_7 Band_7_C Band_7_1 Flot
Other DBs
NCBI-ProteinID: ACQ94141
UniProt: C4LAG6
Position
2776645..2777565
AA seq 306 aa
MDLSLPLLVIFIVLVLVSLGSVIKVVPQGYNWTVERFGRYTTTLSPGLNLIVPFVDRIGR
KINMMEQVMDIPPQEIISRDNANVTIDAVTFIQVVEAHKAAYEVNDLMSAIKNLTMTNIR
TVLGAMELDHMLSQRDTINEKLLVTVDAATSPWGVKVTRIEIKDVRPPQDLIEAMNAQMK
AERQKRAEILEAEGIRQSKILKAEGEKQSQILKAEGERQAAFLASEARERQAEAEAKATQ
LVSDAIANGNTQAINYFIAQKYTEALAKIGDGQNSKLVLMPLEASQLIGSIGGISQLLNE
ISPKKG
NT seq 921 nt   +upstreamnt  +downstreamnt
atggatttaagtttaccgctactcgttatttttattgtgctggtattggtgtcactcggt
tccgtaatcaaggttgtgcctcagggctataactggacagtggaacgattcggacgctat
accacgacgctttcacccgggctgaacctgattgtgccttttgttgatcgcattggtcgc
aagatcaatatgatggaacaggtgatggacattccgccgcaggaaatcatttcccgtgat
aacgcgaatgtgaccattgatgccgtgacatttattcaggtggtcgaagcgcataaagcc
gcttatgaagtgaatgatctgatgtccgcaatcaagaatctgacgatgaccaacatccgt
accgtattaggtgccatggaactggatcatatgttgtcgcaacgtgacaccatcaatgaa
aaactgctggtcaccgtcgatgccgccaccagcccctggggtgtgaaggtgacccgtatc
gaaattaaagacgtgcggccaccacaggatctgatcgaggcgatgaatgctcagatgaaa
gctgaacgtcagaaacgcgcggaaatcctggaagcggaagggatccggcaatctaaaatt
ctgaaggcggaaggggaaaaacagtcacagatcctgaaagcggaaggtgaacgtcaggct
gccttcctcgcctcggaagcacgtgaacgtcaggcagaagcggaagccaaagccactcag
ctggtttctgatgcgatagctaacggcaacacccaggccatcaattattttatcgcacaa
aaatatactgaagcgctggctaaaattggtgatgggcaaaacagtaagctggtcttgatg
ccgctggaagcctcacagctgattggttcgatcggtgggatcagtcaactgcttaatgag
atctctccgaagaaggggtaa

DBGET integrated database retrieval system