KEGG   Tolumonas auensis: Tola_2548
Entry
Tola_2548         CDS       T00904                                 

Definition
(GenBank) protein of unknown function DUF107
  KO
K07340  inner membrane protein
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    Tola_2548
SSDB
Motif
Pfam: NfeD Glucan_synthase TatA_B_E
Other DBs
NCBI-ProteinID: ACQ94142
UniProt: C4LAG7
Position
2777568..2778038
AA seq 156 aa
MHSWAWLSLSDWSYWHWLILGAVLLLLELFGTAGLLLWTGISALLTALMVFVFEPGLFAQ
WSLFAVFSIITTWFWFRLNKQDKPTTEVKALNQRTTRCIGAQTTLLEDVKLGKSRVRIED
TVWGVLSSETLPAGTAVKVVAAEGTTLIVKALPVHH
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcatagctgggcatggttgtcattgtctgactggagttactggcactggctgattttg
ggcgcggtattattactgctggaactgttcggtacggccggtctgttactctggaccggc
atatccgccctgctgaccgcgttaatggtttttgttttcgaaccgggactgtttgctcag
tggagtctgtttgcggttttcagcatcatcacgacctggttctggtttcggcttaacaaa
caagataaaccaacaactgaagtaaaagcgctgaatcaacgcaccactcgctgtatcggt
gcacaaaccacgctgctggaagatgtcaaactggggaaaagccgggtaagaattgaagat
actgtctggggcgtgttatccagcgaaacattaccggcaggcactgcggtcaaagtcgtt
gctgccgaaggaacaacactgatcgtcaaagcattaccagttcaccattag

DBGET integrated database retrieval system