KEGG   Tolumonas auensis: Tola_2549
Entry
Tola_2549         CDS       T00904                                 

Definition
(GenBank) malate dehydrogenase, NAD-dependent
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
tau  Tolumonas auensis
Pathway
tau00020  Citrate cycle (TCA cycle)
tau00270  Cysteine and methionine metabolism
tau00620  Pyruvate metabolism
tau00630  Glyoxylate and dicarboxylate metabolism
tau00680  Methane metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
tau01200  Carbon metabolism
Module
tau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tau_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tola_2549
   00620 Pyruvate metabolism
    Tola_2549
   00630 Glyoxylate and dicarboxylate metabolism
    Tola_2549
  09102 Energy metabolism
   00680 Methane metabolism
    Tola_2549
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Tola_2549
Enzymes [BR:tau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Tola_2549
SSDB
Motif
Pfam: Ldh_1_C Ldh_1_N
Other DBs
NCBI-ProteinID: ACQ94143
UniProt: C4LAG8
Position
complement(2778306..2779295)
AA seq 329 aa
MKITVLGAAGGIGQALSLLLKMKLPAGFKLALYDVAPVAPGIAVDLSHIPTDVAVKGFTG
DDLPKALEASNVVVICAGIARKPGMHRADLFKFNAGVTRDLISAGAAICPNACFCIITNP
VNSMVPIAAEVLKKAGVYNPQKLFGVTMLDVIRAETFVANFLGRAAGTIRVNVIGGHSGK
TILPVMSQVGGFEFTDEEAAALVRHIQDAGTEVVDAKAGNGSATLAMAAAGYRFINAVVR
GLMEEENVIECAYVEGGSQHSRFFSQPMRLGKEGWYKVLPYGPLTQAEKDSLDLMLPTLR
DEIRMGEDFVLKPELFQDQPAEAGKAEKN
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaaaataactgttctcggtgctgctggtggtataggccaagccttgtctttattattg
aaaatgaaattgcctgcaggatttaaactggcattgtatgacgtggcgccggtggctccg
ggtattgcagttgatttgagtcatattcctactgatgttgccgtgaaagggtttaccggt
gacgatcttcccaaagcactggaagccagtaatgtggtggtgatttgtgccggaattgcg
cgtaagccgggcatgcaccgggctgatctgttcaagtttaatgccggagtgacccgcgat
ctgatttctgccggagcggctatctgtccgaatgcctgtttctgcattatcaccaatccg
gtgaacagcatggtgccgatagcggcggaagtgctgaaaaaagccggggtgtataacccg
cagaaactgtttggtgtcaccatgctggatgtgatccgggcagaaacgttcgttgcgaat
tttttaggtcgggctgcaggtacaatccgggtcaatgtgattggtggtcacagtggcaaa
accattctgccggtgatgtcgcaggtgggtggctttgaatttactgacgaagaagcggct
gccctggtccgccacattcaggatgccggtaccgaggtggtagatgcgaaagcggggaat
ggttctgccacgctggcgatggcggctgcgggataccgcttcattaacgcggtagtccgt
gggctgatggaagaagagaacgtgatcgagtgcgcctatgtggaaggtggcagtcagcac
agccggttcttctcacagccgatgcgtctgggtaaagagggctggtacaaggtattgccg
tatggtccgctgactcaggcagaaaaagattcactggatctgatgctgccaacgttacgt
gatgaaatccggatgggtgaggactttgtgctgaagcccgagctgtttcaggatcaaccg
gcagaagccgggaaagcggaaaaaaactag

DBGET integrated database retrieval system