KEGG   Tolumonas auensis: Tola_2550
Entry
Tola_2550         CDS       T00904                                 

Definition
(GenBank) arginine repressor, ArgR
  KO
K03402  transcriptional regulator of arginine metabolism
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tau03000]
    Tola_2550
Transcription factors [BR:tau03000]
 Prokaryotic type
  Other transcription factors
   Others
    Tola_2550
SSDB
Motif
Pfam: Arg_repressor_C Arg_repressor
Other DBs
NCBI-ProteinID: ACQ94144
UniProt: C4LAG9
Position
2779590..2780060
AA seq 156 aa
MKPGEKQEQLVKAFKALLREERFGSQAEIVTALNEIGFENINQSKVSRMLSRFGAVRTRN
AKMEMVYCLPVELGIPTINSPLKNLVLDVDHNGVILVIHTTPGAAQLIARMLDSLGKAEG
ILGTIAGDDTIFITPTAESDIDELYDSVLELFEHTG
NT seq 471 nt   +upstreamnt  +downstreamnt
atgaaacccggcgaaaaacaggaacaactagttaaggctttcaaggccttgttgcgggaa
gagcggttcggctcacaagccgaaatagtgactgcactgaacgaaatcggttttgagaat
atcaaccagtccaaggtctcccgcatgctgagccggtttggcgcagtgcgtacccgtaac
gccaaaatggaaatggtctactgtctgcccgtcgaactggggatcccgaccatcaacagc
ccgctgaagaatctggtgctggatgtggatcacaatggcgtgatcctggtgatccatact
acgccgggcgcagcacaactgattgcccggatgctggattcattaggtaaagcagaagga
attctcggcaccatcgccggggatgacacgatcttcatcaccccgaccgcagaatcagat
attgatgagttgtacgactcggtgctggaactgttcgaacatacgggttag

DBGET integrated database retrieval system