KEGG   Tolumonas auensis: Tola_2551
Entry
Tola_2551         CDS       T00904                                 

Definition
(GenBank) signal transduction histidine kinase regulating citrate/malate metabolism
  KO
K07701  two-component system, CitB family, sensor histidine kinase DcuS [EC:2.7.13.3]
Organism
tau  Tolumonas auensis
Pathway
tau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tau00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tola_2551
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tau01001]
    Tola_2551
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:tau02022]
    Tola_2551
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Tola_2551
Protein kinases [BR:tau01001]
 Histidine kinases
  CitB family [OT]
   Tola_2551
Two-component system [BR:tau02022]
 CitB family
  DcuS-DcuR (C4-dicarboxylate metabolism)
   Tola_2551
SSDB
Motif
Pfam: sCache_3_2 HATPase_c SPOB_a HATPase_c_5 PAS HATPase_c_2 sCache_3_3 HATPase_c_3 PAS_4 PAS_8
Other DBs
NCBI-ProteinID: ACQ94145
UniProt: C4LAH0
Position
complement(2780132..2781742)
AA seq 536 aa
MLGLSSPLKLRTRITLLVCTVIALVLLVVHAIFVTQSTALSKNSLEEKARGVARTLTETP
FVGAALTIPEQQQALQGYIESVRKRNELLFIVVMDMDAIRHTHPDPKMIGLRFQGGDQIK
ALHGEEYISEAKGTLGNSVRVISPLYHNGRQVGAIAVGISTAKVEAIISANLLFAYLALL
FGGLVGAVGAFYLARKIKAIMFGLEPSEIASLLEQRSAMLQSIREGVIAVNAQSEITLIN
DEAKRLLRLSGSSDELLQEQGSKNWPKRLHLQEVLQTGVAQYDEELKFNGLVLLSSSVPV
RVNGTIVGAVMSFRDKTEVSQLVQRLSGMSNYAEALRMQAHEFMNKLQVILGMVNIRAFE
QLEHYIMGIAGQYHSDVGALIRQIKDPVIAGFLLGKINRAREAGITVIVTEDSFLPESSQ
LDQPHALVTILGNLLENAIDALEGVPDPTITVALDYEEGSLFCVVKDNGKGIPPEVIPHI
FERGFSTKGTQRGLGLYLVKQSLAKLEDSSIECRNNPDRGASFIVTLPYAGKETES
NT seq 1611 nt   +upstreamnt  +downstreamnt
gtgctcggactgtcttctcctctgaaacttcgtacccgaattactttgcttgtttgtacc
gtgattgcactggttttactggtggtgcatgccatatttgtcacgcaatcgacggcgctc
agtaaaaacagtctggaagaaaaggcccggggcgtggcccgtacactgaccgaaacacct
tttgtcggtgcggcgctcactattccggaacagcagcaagccttgcagggctatatcgaa
tcggtacgcaagcggaatgaactgctgtttattgtggtgatggacatggatgcgatccgt
catacacatcctgatcccaaaatgataggtctgcgttttcaggggggggatcagataaaa
gctctgcacggagaggaatacatttcagaagcgaaaggcacactgggtaattcagtgcgt
gtgattagcccgctctatcataatggccgacaggttggggccatcgcggtagggatctcg
accgctaaagtagaggcgattatctcggccaacctcctgtttgcttatctggcgttgtta
tttggcggattggtcggcgcggtaggtgcgttttatctggcccgtaaaatcaaagcgatc
atgtttggcctggaaccctccgaaatcgccagtttactggagcaacgcagtgcgatgttg
caatcgattcgtgagggtgtgattgccgtcaatgcgcagtctgaaattacgctgatcaat
gatgaggcaaaacgtctgttacggctgagcggttcgtccgatgaactgctgcaggagcag
ggcagtaaaaactggccgaagcgtctgcatttacaagaagtactgcagacgggcgttgct
cagtatgatgaagaactgaagtttaacgggctggttttgctgagcagtagtgtaccggtg
cgggtgaacggaacgatcgtcggggctgtcatgtcgttccgtgacaaaacagaggtcagt
cagctggttcaacgcctcagcggcatgtcgaattatgcggaagcgctgcgtatgcaggcg
cacgagtttatgaacaagttgcaagtcattctgggcatggtgaatatccgggcttttgag
cagctggaacattacatcatggggattgcagggcaatatcacagtgatgtcggtgcattg
atccgtcaaattaaagacccggtcattgccggatttctgctgggtaaaatcaaccgggcg
cgtgaagcgggaattacagtgatcgtcaccgaggatagtttcctgccagaatccagccag
ctggatcagcctcatgctctggtgacgattctcggcaatctgctggaaaatgccattgat
gctctggaaggcgtcccggatccgaccatcacggtggcactggattacgaagagggttcc
ctgttttgtgttgtcaaagataacgggaagggtattccaccggaagtgatcccccatatt
ttcgagcgcggtttttccaccaagggaacacagcgggggctgggtctctatctggtcaaa
caaagtctggcaaagctggaagacagttcgattgaatgccggaacaacccggaccggggt
gccagctttatcgtgaccctgccttatgccggcaaggagacggaatcgtga

DBGET integrated database retrieval system