KEGG   Tolumonas auensis: Tola_2552
Entry
Tola_2552         CDS       T00904                                 

Definition
(GenBank) hydro-lyase, Fe-S type, tartrate/fumarate subfamily, beta subunit
  KO
K01676  fumarate hydratase, class I [EC:4.2.1.2]
Organism
tau  Tolumonas auensis
Pathway
tau00020  Citrate cycle (TCA cycle)
tau00620  Pyruvate metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
tau01200  Carbon metabolism
Module
tau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tola_2552
   00620 Pyruvate metabolism
    Tola_2552
Enzymes [BR:tau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     Tola_2552
SSDB
Motif
Pfam: Fumerase_C Fumerase
Other DBs
NCBI-ProteinID: ACQ94146
UniProt: C4LAH1
Position
complement(2781960..2783609)
AA seq 549 aa
MPNKPFYYQDPFPLAKDETEYYLLTKDHVSVSEFEGQEILKVAPEGLTLLAQQAFHDASF
MLRTSHQKQVAAILHDPEASENDKYVALQFLRNSEISAKGVLPTCQDTGTALIMGKKGQR
VWTGGDDEAALTRGVYNTYTEDNLRYSQNAALDMYKEVNTGTNLPAQIDLYSVNGDEYKF
LCVAKGGGSANKTYLYQETKALLTPDTLKKFLVDKMRSLGTAACPPYHIAFVIGGTSAES
TLKTVKLASTHYYDALPTEGNEHGQAFRDVQLEQELLKEAQNLGLGAQFGGKYFAHDIRV
IRLPRHGASCPLGMGVSCSADRNIKAKINRDGIWIEKLESNPAQYIPEELRQQGEGDAVQ
VDLNRPMQEILAQLSQYPVATRLSLSGTIIVGRDIAHAKLKERLDKGEGLPQYVKDHPIY
YAGPAKTPAGYASGSLGPTTAGRMDSYVDLLQSHGGSMIMLAKGNRSQQVTDACHKHGGF
YLGSIGGPAAVLAQESIKSLECVEYPELGMEAIWKIEVENFPAFILVDDKGNDFYQQILN
KQCANCTMK
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgccaaataaacctttttattaccaggatccgttcccgctcgctaaagatgaaaccgaa
tactatctgctgacgaaagatcatgtctccgtgagcgaattcgaaggtcaggagatcctg
aaagtcgcacctgaaggtctgactttactggctcagcaggcttttcatgatgcatccttc
atgctgcggacgtcccaccagaagcaggttgccgctattcttcatgatccggaagccagc
gaaaacgacaaatatgttgcgctgcaattcctgcgtaactcagaaatttcagccaaaggc
gttctgcctacctgtcaggataccggtacagccctcatcatggggaaaaaaggccagcgt
gtctggaccggtggtgatgatgaagcagccctgacccggggtgtttacaatacctataca
gaagacaatctgcgttactcccagaatgccgcgctggatatgtacaaagaagtgaataca
gggacaaacctgccggctcaaatcgacctttacagcgtcaatggcgatgaatacaaattt
ctgtgtgtcgccaaaggtggtggttcagccaacaaaacctacctgtatcaggaaactaaa
gcactgctgactccggacacactgaaaaaattcctggtcgataaaatgcgttcgctggga
actgcagcctgcccgccataccacattgcatttgtaattggtggcacctctgcggaaagc
acgctgaaaaccgtgaaactggcttctacgcattactatgatgcgctgccaaccgaaggt
aacgagcatggtcaggcattccgtgatgttcagctggaacaggaactgctgaaagaagcg
cagaatctgggtctgggtgctcagtttggtggtaaatatttcgcgcatgatatccgcgtg
atccgtctgccgcgtcacggtgcatcttgtccgcttggtatgggtgtttcctgctctgct
gaccgtaatatcaaagcgaaaatcaaccgcgatggtatctggattgagaaactggaaagc
aatccggcgcagtacatccctgaagaactgcgtcagcaaggggaaggtgatgccgttcag
gttgatctgaaccgtccgatgcaagagatcctggctcagctttctcaatatccggtggct
actcgtctgtctctgtccggtactatcatcgtaggtcgtgacattgcccacgcgaaactg
aaagagcgtctggataaaggcgaaggtctgccgcaatacgtgaaagatcatccaatctat
tacgctggcccggccaaaactccggctggttacgcctctggttctttaggcccgactacg
gcaggtcgtatggattcttacgttgatctgctgcagtcacatggcggcagcatgatcatg
ctggcgaaaggcaaccgtagccagcaggttacagatgcgtgccataaacacggtggcttc
tatctgggcagcattggtggcccggctgccgttctggcgcaggagagtatcaagagcctg
gaatgtgtggaatatccggaactgggtatggaagcgatctggaagattgaagtggaaaac
ttcccggcgtttattctggtcgatgataaaggcaatgatttctaccagcagatcctgaac
aaacagtgtgccaactgtacgatgaagtaa

DBGET integrated database retrieval system