KEGG   Tolumonas auensis: Tola_2553
Entry
Tola_2553         CDS       T00904                                 

Definition
(GenBank) anion transporter
  KO
K11106  L-tartrate/succinate antiporter
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tau02000]
    Tola_2553
Transporters [BR:tau02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Tola_2553
SSDB
Motif
Pfam: Na_sulph_symp CitMHS
Other DBs
NCBI-ProteinID: ACQ94147
UniProt: C4LAH2
Position
complement(2783724..2785235)
AA seq 503 aa
MKEMSIPIDTQLVDKASDGKLNRLFFMLAPFVVTALLLLMPVPEGLQPYAWYYFAIFVGV
IVGLIFEPLPGAVIGLTGVVAIALTSQWVLFSPEDMAAPKFKLAAESFKWAVSGFGNSTV
WLIFGAFMFAAGYDKTRLGRRLALILVKYLGRRSLTLGYAIMFADLLLAPFTPSNTARSG
GTIYPIIANLPPLYGSKPNDPSARKIGSYLMWVAITATCITSSMFLSALAPNLLALALVK
STVGISISWGNWFVAFLPLGILFLLTMPLLAYWFYPPEVKFNDEVPRWASAELVKLGRLS
RNEILLLVFVCAALIMWIFAASVIEPAMAALLIIGLMLWTGVLEWNDITSNKAAWNTFFW
FATLVALAGGLSSTGFIAWLGKEGGMLMSGISAGTATVMLLVAFYLLHYLFASATAHTTA
LLPAMLTIASTIPGMNMEVFCMLMVTSLGVMGIITPYGTGPSPIYYGSGYLPTADYWRLG
TIFGAIFLVALLVIGYPWMVMMF
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgaaagaaatgagtataccaatcgacactcagttggtcgataaagcatcagatggtaag
ttaaaccgcctcttctttatgttggctccgttcgtggtgacggctctattgctgttgatg
ccagtccccgaaggattacaaccctacgcatggtattactttgccattttcgttggggtt
atcgtcggtctgatctttgaaccgctaccaggcgcggtcattggcctgaccggggtggtc
gcgatcgcactgaccagtcagtgggtgctgttcagtcctgaagatatggctgcccctaaa
ttcaaactggctgctgaatcattcaaatgggccgtcagtggatttggtaattccacggta
tggctgatctttggtgcgttcatgtttgccgcgggctacgataaaacccgcctcggacgc
cgtctggcattgattctggtgaagtatctgggacgtcgcagcctgacactgggttatgcg
atcatgtttgcggatctgctgctggcaccgtttacaccatcgaataccgcacgcagtggg
ggaactatctacccgattattgccaacctgccaccgctgtacggctctaaaccgaacgat
ccgagtgcacgtaaaatcggctcttacctgatgtgggtggcgatcaccgcgacctgtatc
accagttcgatgttcctgtctgcgctggcaccgaacctgctggcactggcactggtaaaa
agtaccgtgggtatcagcatcagctggggaaactggtttgttgccttcctcccgctgggc
attctgtttcttctgaccatgccgctgctggcgtactggttctatccgccagaagtgaaa
ttcaacgatgaagtacctcgctgggcaagtgccgagctggttaaactgggtcgtctgtcc
cggaatgaaattctgctgctggtcttcgtttgtgctgcgctgatcatgtggatcttcgct
gccagcgtgattgaacctgcgatggctgcactgctgatcatcggtctgatgctgtggacg
ggggttctggagtggaacgacatcaccagtaacaaagccgcatggaacacctttttctgg
ttcgcgacactggttgcactggcgggcggattatcatcgaccggtttcattgcctggttg
ggtaaagaaggcggcatgctgatgagcggtatctccgccggcaccgcgacagttatgttg
ttggtggcgttctacctgctacattatttatttgccagcgcaacagcgcacaccacggcg
ctgcttcctgcgatgctgaccattgcatcgacgattccgggaatgaatatggaagtcttc
tgtatgctgatggtgacatcgctgggtgtgatgggcattatcaccccatacggcactggt
ccgagcccgatttactatggtagtggttacctgccaaccgccgattactggcgactggga
accatttttggtgccatcttcctggtagccttgttagtcatcggttacccatggatggtc
atgatgttctga

DBGET integrated database retrieval system