KEGG   Tolumonas auensis: Tola_2555
Entry
Tola_2555         CDS       T00904                                 

Definition
(GenBank) ApbE family lipoprotein
  KO
K03734  FAD:protein FMN transferase [EC:2.7.1.180]
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tola_2555
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.180  FAD:protein FMN transferase
     Tola_2555
SSDB
Motif
Pfam: ApbE
Other DBs
NCBI-ProteinID: ACQ94149
UniProt: C4LAH4
Position
2788898..2789929
AA seq 343 aa
MFASALRVSALAFNHYSTGVIPMSSVERVYSYSAVLMGSPILLKLFEDNQQAAQAVFHLI
KQQEDMLTVNRAHSQLMTINHAAGLHPVVVSRPVFELISKAKTVSLMQDSCFNFTIGPLV
KRWKIGFHGDTVPSPAEIQSLLPLTRPDQVMLDPQACSVYLAQAGMEIDLGAIAKGYIAD
RVRDLLQQMGIHQALINLGGNVLTLGTPRYGDQSAWGVGLKKPFAAPDALIGIIEVAGKS
VVTSGIYERYFEQEGKIYHHILDPETGYPLDNELLSVTVISDDSVDGDIYTTLLYGMGVK
KALHYLTTVPHIEAIFVTRTGQVILSSQRQFRFTLQDSDYQLA
NT seq 1032 nt   +upstreamnt  +downstreamnt
gtgtttgccagtgcgctccgggtgagtgcactggctttcaaccactattcaaccggggtg
atccctatgtcatccgtagaacgggtctattcttactccgctgtcctgatgggctccccc
atcctcctgaaactcttcgaagataatcaacaagccgcccaggccgtctttcacctgatc
aagcaacaggaagatatgctgacggtgaatcgtgcacactcgcaactgatgaccatcaat
catgccgccggtttgcacccggtggtagtcagtcgtccggtgtttgagctgatcagcaaa
gcgaaaaccgtcagtctgatgcaagacagctgttttaatttcaccattggcccgctggtc
aagcgctggaaaatcggttttcacggcgacaccgtgccgtctccggcagaaatccagtct
ctgttgccgctgacccgtccggatcaggtcatgctcgacccgcaggcctgttccgtttat
ctggcacaggcaggcatggaaatcgatctgggtgcgattgccaaaggctatattgccgat
cgggtacgggatctgctgcagcagatgggcattcatcaggcgctgattaatctgggtgga
aacgtcctgacactcggaacccctcgctatggagatcagagtgcatggggagtcgggtta
aaaaaaccgtttgccgccccggatgcgctgattggcatcatcgaagtggccggcaagtcg
gtggtcacatccggcatttatgagcgttattttgagcaagagggaaagatctaccaccat
attctggatccggagaccggctatccgctggataacgaactgctcagtgtcaccgtgatc
tcagacgactcggtggatggcgatatttacaccacgttgctgtatggcatgggcgtaaag
aaagccctgcactatctcaccaccgtgccccatattgaggcgatctttgtcacccgaacc
ggtcaggtgattctgtcgtcacaacgccagttccgcttcaccttacaggatagcgactac
cagctggcgtaa

DBGET integrated database retrieval system