KEGG   Tolumonas auensis: Tola_2556
Entry
Tola_2556         CDS       T00904                                 

Definition
(GenBank) response regulator receiver and unknown domain protein
  KO
K07703  two-component system, CitB family, response regulator DcuR
Organism
tau  Tolumonas auensis
Pathway
tau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tau00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tola_2556
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:tau02022]
    Tola_2556
Two-component system [BR:tau02022]
 CitB family
  DcuS-DcuR (C4-dicarboxylate metabolism)
   Tola_2556
SSDB
Motif
Pfam: Response_reg INCENP_N CENP-L
Other DBs
NCBI-ProteinID: ACQ94150
UniProt: C4LAH5
Position
complement(2789954..2790688)
AA seq 244 aa
MINVLIVDDDAMVAELNHRYVTQLRGFQCCGVASTLEQAKALVLNHQHPIDLILLDVYMQ
QENGLDLLPVLRNAHRPIDVIMISSASDAETIKKSLHYGVVDYLIKPFQFARFEEALTSW
AKKKTLMDNQQNYQQSELDRIIHGTPMQAQRPEGEAKRLPKGLTPQTLRTICQWIDSHSG
IDFSTEDLASSVLISRVSCRKYLVWLEEIKILHTSVHYGMTGRPVYRYRLQPELHARLKQ
YAQD
NT seq 735 nt   +upstreamnt  +downstreamnt
gtgatcaatgttttaattgtcgatgatgatgccatggttgccgagctgaaccaccgctat
gttacccagcttcgtgggtttcaatgctgtggtgtggcctcaactctggaacaggcgaaa
gcgctggtgttaaaccatcagcatccaatcgacctgatcctgctggatgtctatatgcag
caggaaaatggtctggatctgctgccggtgctgcgtaacgcgcatcgtccgattgatgtg
atcatgatttcttccgcttccgatgcggaaaccatcaagaagtcactgcattacggtgtg
gtcgattatctgatcaagcctttccagtttgcccggtttgaggaagcattaaccagctgg
gcaaagaaaaagacgctgatggacaatcagcagaattatcagcagtcggaactggatcgc
atcatccacggtaccccgatgcaggcacagcgtccggaaggtgaagccaaacggttaccg
aagggcttaaccccgcaaaccctgcgcaccatctgtcagtggattgacagtcattcaggc
attgatttctcgacggaagatcttgccagctcggtactgatttcacgcgtctcctgccga
aaatatctggtctggctggaagagatcaagatcctgcacaccagtgtccattacggcatg
accggcagaccggtttaccgttaccgcttacagccggaactgcatgcccggttgaaacag
tatgctcaggattaa

DBGET integrated database retrieval system