KEGG   Tolumonas auensis: Tola_3128Help
Entry
Tola_3128         CDS       T00904                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tau  Tolumonas auensis
Pathway
tau00860  Porphyrin and chlorophyll metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
Module
tau_M00121  Heme biosynthesis, glutamate => heme
tau_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tola_3128
Enzymes [BR:tau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Tola_3128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DNA_pol_lambd_f
Motif
Other DBs
NCBI-ProteinID: ACQ94716
UniProt: C4LDV5
Position
3426889..3427614
Genome map
AA seq 241 aa AA seqDB search
MTPLILRPQPAAGELAAYLRRDGHTPVVCPLLTYQPGDELALLPALLKQAEITLAVSAAA
VQFASRHLQQQKILWPPALTYLAVGPATAAEWQQQGLRVISPADARSEGLLAQPALQSVN
GKKIVILRGNGGRELLTETLRHRGAQVSCVECYRRHYLQTDGARLLQEWQAAAVDSVIIT
SSELFRQLLILLPDTAGNWLSALRWFVASERIAEEIRHSGFKQITIMSGAQHQAVAAALS
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgttaatcctgcgtccgcagcctgccgccggtgaactggcggcatatttgcgg
cgtgacggccacacaccggtagtctgcccgttactgacttaccagccaggcgatgagtta
gccttattaccagccctgctgaagcaggcggagatcaccctcgcggtgagtgccgctgcc
gtacaatttgccagccgccacttacagcaacaaaaaattctgtggccaccagcgctgact
tatctggcggtcggcccggcgacggcagccgaatggcagcaacaagggctccgcgtcatc
tcgcctgccgatgcccgcagcgaaggtttgctggcgcagcccgcactgcaatcggttaac
ggaaagaaaatcgtgatcctgcgcggtaacggtggccgcgaactgctgacggaaacctta
cgccaccgcggtgcgcaggtttcctgtgttgaatgttaccgtcgtcactatctgcaaaca
gacggcgcccgtttattacaggaatggcaggcagccgcggtggacagtgttatcatcact
agtagtgaattatttcggcaattactgatcctgttacccgataccgccggaaattggtta
tcagcactacgctggtttgttgccagcgaacgcatcgcggaagagatcaggcattcagga
tttaaacaaataacgattatgtccggcgcacagcatcaggctgtggcggctgcattatca
gaataa

DBGET integrated database retrieval system