KEGG   Tabrizicola sp. K13M18: EI545_04075Help
Entry
EI545_04075       CDS       T05742                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
taw  Tabrizicola sp. K13M18
Pathway
taw00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:taw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EI545_04075
Enzymes [BR:taw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     EI545_04075
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     EI545_04075
    1.1.1.-  
     EI545_04075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 ADH_N_assoc Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AZL58085
UniProt: A0A3S8U3E6
Position
849593..850660
Genome map
AA seq 355 aa AA seqDB search
MRAIRFHGAKDIRVEDVAEPSGPLAPDDVLIAPAVTGICGTDLHEYIAGPIVTPKEPHIF
TGASNPQILGHEFSARVLAVGDAVSHVKAGDRISIQPLLSPRNDYYGKRGLYHLSPKMGC
VGLSWAWGGMAEKAIVKDYNAQPVPDGITDDQAAMIEPAAVALYGVDRGGITAGSTVLVS
GAGPIGALTILAAKAAGASTIIVSEPNPNRRRIISEIAPYAHVVDPRDGTLAQVVGDLTE
EGVGVDVALECVGLEASLNACVQAVRRQGKVVQVGLHMKPASIDAMLWALKDITVEATWC
YPTQIWPRIARMIAAGTFPVEKVITARIDAKDVVAKGFEALLNPTGEHLKILVTT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaattcggttccacggtgccaaggacatcagggttgaggatgtggcagaacca
tcagggccacttgcgccggatgacgtgttgatcgcccctgctgtcaccggcatttgcggc
accgacctgcatgaatacatcgctgggccgatcgtcaccccgaaagagccgcacatcttc
actggtgccagcaatccgcagatcctggggcatgagttttccgcccgcgtgctggcggtg
ggcgatgccgtcagccatgtgaaggcgggggatcgcatctcgatccagccgcttctgtcg
ccgcgcaatgactattacggcaagcgtggtctttaccacctgtcgccgaagatgggctgt
gtgggcctgagctgggcctggggcgggatggccgaaaaggccatcgtcaaagactacaat
gcccagccagtgccggacggcatcaccgacgatcaggccgcgatgatcgagcctgcggcg
gtggcgctttatggggtggatcgcggcgggatcacggcgggatcaacggtgctggtgtcg
ggagcagggccaatcggggcgctgacgatccttgcggccaaggcggcgggggcatcgacc
atcatcgtgtccgaaccgaacccgaaccggcggcgcatcatctctgagatcgcgccctat
gcccatgtcgtggacccgcgcgatggcacgctggcacaggttgttggcgacctgaccgag
gaaggcgtgggcgttgacgtggcgctggaatgcgtcgggcttgaagcgtcgctgaacgcc
tgcgtgcaggcggtgcggcggcagggcaaggtcgtgcaggtggggctgcacatgaagccc
gccagcattgacgcgatgctttgggcgctaaaggacatcacggttgaggcaacgtggtgc
tatccgacgcagatctggccgcgcatcgcccggatgatcgcggcaggcacattcccggtg
gaaaaggtgatcaccgcccgcatcgacgccaaggatgtggtggccaaggggttcgaggcg
ctgctgaacccgacgggcgagcatctgaagattctggtcacgacctga

DBGET integrated database retrieval system